(data stored in ACNUC7421 zone)

EMBL: CP001743.PE36

CP001743.PE36        Location/Qualifiers
FT   CDS_pept        31522..32235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0037"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; SPTR:
FT                   A3VF44 Putative protocatechuate dioxygenase; InterPro
FT                   IPR000627:IPR002052:IPR006311; COGs: COG3485
FT                   Protocatechuate 3 4-dioxygenase beta subunit; KEGG:
FT                   noc:Noc_2416 intradiol ring-cleavage dioxygenase; PFAM:
FT                   Dioxygenase; TIGRFAM: Tat (twin-arginine translocation)
FT                   pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26818"
FT                   /protein_id="ADD26818.1"
FT                   /translation="MDNDDKPIGTILNRRKVLAALGLGGLAGVGGLMNGQRAAAQNNAL
FT                   PSCIVRPALTEGPYFVDVQLNRSDIRSDPTTGVVKPGVPLSLRFVVSRVSASGCTPLPG
FT                   AMVDIWQCDAQGLYSGVQDRFADTRGQKWLRGYQITDAQGVAQFTTIYPGWYPGRTVHI
FT                   HFKIRYQNRDFTSQLFFDDALSDRIFANPPYVKTGTRTRNANDSIYRNGGSQLLLNLTQ
FT                   SGQGYAATFDIGLNL"
     atggataacg acgataaacc gattggaacg attctgaacc gccgtaaggt gctggccgcc        60
     ctgggcctgg gcgggctggc cggggtgggt gggctaatga atggacagag ggccgcagcc       120
     cagaacaacg ccctgccttc ctgcattgtg cgcccggccc tgaccgaggg gccctacttt       180
     gtggatgtcc agctcaaccg ctccgatatc cgctccgacc ccaccacggg ggtggtgaag       240
     ccaggggtgc ccctgagcct gcgctttgtg gtctcgaggg tctcggccag cggatgcacc       300
     ccactgccgg gggccatggt ggacatctgg cagtgcgacg cccagggcct ctactccggg       360
     gtacaggatc gcttcgccga cacccgcggg cagaagtggc tgcgcggcta ccagattacc       420
     gatgcccagg gggtggccca gttcaccacc atctaccccg gctggtatcc gggccgcacc       480
     gtgcacatcc acttcaaaat tcgctaccag aaccgcgact tcacctcgca gctcttcttc       540
     gacgatgccc tgagcgaccg catttttgcc aacccgccct atgtgaaaac gggcacccgc       600
     acccgcaacg ccaacgacag catctaccgc aacgggggga gccagctttt gctcaacctg       660
     acccagagcg ggcagggcta tgccgctacc tttgatattg gactgaacct ctag             714
//

If you have problems or comments...

PBIL Back to PBIL home page