(data stored in ACNUC7421 zone)

EMBL: CP001743.PE362

CP001743.PE362       Location/Qualifiers
FT   CDS_pept        345260..347326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0367"
FT                   /product="Ig domain protein group 2 domain protein"
FT                   /note="PFAM: Ig domain protein group 2 domain protein;
FT                   SMART: Ig domain protein group 2 domain protein; InterPro
FT                   IPR003343:IPR010916; KEGG: mxa:MXAN_5490 hypothetical
FT                   protein; SPTR: A1ZK61 Cell surface protein, putative; PFAM:
FT                   Bacterial Ig-like domain (group 2)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27144"
FT                   /protein_id="ADD27144.1"
FT                   /translation="MTYRWFVLLLAALFLAACGGGGAPSINTIEVSPSSASKQVGQTQQ
FT                   FTAVAKDAGGNVISGVTFTWSSSNTAVATVNNSGLATAVAAGTATITASAGGKSGSATF
FT                   TVTNPAPPTIETIEVSPSSASKQVGQTQQFTAVAKDAGGNVISGVTFTWSSSDTAVATV
FT                   NNSGLATAVAVGTATITATAGGKSGSATFTVTPTPTYTVGGEVRYLNGSGLVLALGSQT
FT                   KTISSNGPFTFDTPVQDGTYSVSVQTQPTNPSQNCTVTPSSVTVSGANVTNLVVECSPY
FT                   TKWLASSATDIGNAITTDAQGNVIVAGLSKEVLGDEVGTLALAFPDVVVAKYAPNGSRL
FT                   WVKQFTVGDPSTPGSAESQAKGVATDAAGNIYVVGSAYVASSNAFKGFILKLSPAGAKL
FT                   TSIKLDENTLNVENGLTSVAVVGSDVYVGGYTAGTVPSGTNAGGEDAALYKYDTGLTLQ
FT                   WARQLGSTGSDRITSVAVDASGAVYAAGFAGGALPSKTHLGDTDAFVVKYDNAGTQQWL
FT                   EQFGTAYGDGANAVAVQGSDVYVAGYVTGAYGTGFSYNGGTDLFVTKFSSSGTETWRRQ
FT                   YSPTDPAQINPYGMVADASGNVYIVGDVNVSVDGTATHAGAKDVFILQYLADGTVGWAR
FT                   QQGSTQDEIALAVTLRDSDLYLTGWSKGALDNYTNQGEEDIFVLKYGTDGSKK"
     atgacctatc gctggtttgt actactatta gccgcgctgt tcctggctgc gtgtggggga        60
     ggtggggcgc ccagcattaa caccatcgag gtcagcccgt cttctgccag caagcaggtg       120
     ggccagaccc aacagttcac cgcggtggcc aaggacgcgg gcggcaatgt gatttccggt       180
     gtgaccttta cctggagctc gagcaacacc gccgttgcca ccgtgaataa cagcggcctg       240
     gctactgccg ttgccgctgg cacggccacc atcactgcct cggccggggg caagagcggc       300
     agcgctacct ttaccgtaac caacccggcg cccccgacca tcgagaccat cgaggtcagc       360
     ccgtcttctg ccagcaagca ggtgggccag acccaacagt tcaccgcggt ggccaaggac       420
     gcgggcggca acgtgatttc cggtgtgacc tttacctgga gctcgagcga taccgccgtt       480
     gccaccgtga ataacagcgg cctggctact gccgttgccg tgggcacggc caccatcacc       540
     gccacggccg ggggcaagag cggcagcgct acctttaccg tgacccccac gcctacctac       600
     accgtgggcg gcgaggtgcg ctacctgaac ggcagcggtc tggtgctggc cctgggttcg       660
     cagaccaaaa ccattagcag caacggcccc ttcaccttcg acacccccgt acaggacggc       720
     acctacagcg tgagcgtgca gacccagccc accaacccct cccagaactg caccgtcacc       780
     cccagcagcg tgaccgtgag cggggccaac gtgaccaacc tggtggtgga gtgcagcccc       840
     tacaccaagt ggctggcttc cagcgcaacc gatatcggaa acgccattac caccgatgcc       900
     caaggcaacg tgatcgtggc cggcctttcc aaagaagtgc tgggtgatga ggtgggcacg       960
     ctcgccctgg ccttcccgga tgtggtggtg gccaagtacg cgcccaacgg cagccgcctg      1020
     tgggtcaagc agttcaccgt gggtgacccc agcacgcccg gcagtgccga gtcgcaggcc      1080
     aaaggggtgg ccaccgacgc cgccggcaac atctacgtgg tgggaagcgc ctacgtcgcc      1140
     agcagcaacg ccttcaaggg ctttattctc aagctaagcc ctgcgggtgc aaagctgacc      1200
     tcgatcaagc tggacgaaaa caccttgaac gtagagaacg gccttaccag cgtggcggtg      1260
     gtgggtagcg acgtgtatgt gggtggctat accgccggaa ccgtgccgag cggaaccaat      1320
     gcaggcgggg aagatgcagc cttatataag tacgacaccg gccttaccct gcagtgggca      1380
     cgacagctcg gctcgaccgg cagcgaccgg attacctcgg tggccgtgga tgcctccggt      1440
     gcggtatacg ccgcagggtt tgccggcggg gccctgccct ccaaaaccca cctgggtgac      1500
     accgacgcct ttgtggtcaa gtacgacaac gcaggaaccc agcagtggct cgagcagttt      1560
     ggtacggcct atggtgacgg ggccaatgcg gtggcagtgc agggttcgga tgtttacgtg      1620
     gccggttatg tgaccggagc ctacgggacg ggctttagct acaacggcgg taccgacctg      1680
     tttgtgacca agttcagtag cagcggtacg gaaacctggc gccgccagta cagccccacc      1740
     gacccagcgc aaattaatcc ctatggcatg gtcgccgatg cctcgggcaa cgtctacatc      1800
     gtgggggatg tcaatgtttc ggtagacggt acggcaaccc acgccggtgc taaggatgtc      1860
     ttcatcctgc agtatctggc cgacggcacc gtgggctggg cccgccagca aggcagtacc      1920
     caggatgaga ttgccctggc cgtcaccctg cgtgacagcg acctctacct gaccggctgg      1980
     agcaaaggag cgctggacaa ctacaccaac cagggcgaag aggatatctt cgtgctgaag      2040
     tacggcaccg acggcagtaa gaagtag                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page