(data stored in ACNUC7421 zone)

EMBL: CP001743.PE366

CP001743.PE366       Location/Qualifiers
FT   CDS_pept        complement(353148..354590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3111 hypothetical protein; SPTR:
FT                   A6C2D0 Parallel beta-helix repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27148"
FT                   /protein_id="ADD27148.1"
FT                   /translation="MRQLFFLLLVGLITACATDQSAPSPSSSSNQAPSIRILSPSNGAT
FT                   VSGAGTRAEVSISDDKAVTRLTRQVNGGPEQDIAIQPTQSGNIIFWIPLVSGSNTAVIR
FT                   VYDAEGLSASATLNLQVGGSSSGGSGGGSFGTDYGGYTLPSGPTYYVSPSGSNANDGSR
FT                   ERPWATLSFAVQKLKPGDVLRVLPGSYNESVQVTASGTSSQRITIASDIRWGAKLNAQG
FT                   NLFGIDVRGSYVDIVGFEVTNATNSGIISWAPYNRFLFNHVYGIRAQCDSNGGAGVNMS
FT                   SPDSSDGVMLGNLVHDIGDLSAGFCTRIHGIYQGAPRGLVQNNITYRARGFGITSWHAA
FT                   TAVTISNNLSFANLYGGISVGSGDNTRGNRAENFLVANNIVVGNPRGISEEGNTGVNRF
FT                   VNNLVWNNTTNWRLQTSTQQGSLSLDPGFVNFQPDGSGNYTLQSSSPAIDKGITERAPA
FT                   IDFQAKPRLQGSAPDLGPFEVR"
     atgcggcaat tgttcttcct tttactggtt gggttaataa cggcctgcgc cactgaccaa        60
     tcggcgccct ccccttcctc gtcttccaat caggcgccca gtatacgcat ccttagcccg       120
     tccaacgggg ccaccgtcag cggcgctggc accagagcag aggttagcat cagcgacgat       180
     aaggccgtta cccgcctaac ccgccaggtg aacgggggcc ctgagcaaga catcgccata       240
     cagcccaccc agagcggcaa cattatcttt tggattccgc tggtgagcgg tagcaacacc       300
     gcggtcatcc gggtctacga tgccgaaggg ctaagcgcca gcgccactct gaacctgcag       360
     gttggcggct caagtagcgg cggttcgggt ggtggttcgt ttggcacaga ctacggcggc       420
     tacaccctgc ccagcggccc cacctactac gtaagcccct ccggcagcaa cgccaacgac       480
     ggctcccgcg aacgcccctg ggccaccctc tccttcgccg tgcagaaact taagcccggc       540
     gatgtcctgc gggtgctccc aggctcctac aacgagtctg tccaggttac cgcctccggt       600
     acgtccagcc agcgcatcac catcgcctcc gatatccgct ggggcgccaa actcaacgcc       660
     cagggcaatc tcttcggtat tgatgtccgc ggcagctacg tggatatcgt cgggttcgaa       720
     gttaccaacg ccaccaacag cggcattatt agctgggccc cctacaaccg cttcttgttc       780
     aaccacgtct atggcatccg ggcccagtgt gactccaacg gcggggccgg ggttaacatg       840
     agctcacccg actcctcgga tggggtgatg ctgggcaacc tggtacacga tattggcgac       900
     ctctcggcag gtttctgtac ccgcatccac ggcatttacc agggtgcccc ccgcggcctg       960
     gtgcaaaaca acatcaccta ccgtgcccgg ggctttggca tcacctcctg gcatgctgcc      1020
     accgctgtga ccatcagcaa taacctctcc ttcgccaacc tatatggcgg catctcggtg      1080
     ggctcaggcg acaacacccg tggcaaccgg gccgaaaact tcctggtagc caacaacatt      1140
     gtggtaggca acccccgtgg catcagcgag gagggcaaca ccggggtgaa tcgctttgtg      1200
     aacaacctgg tctggaacaa caccaccaac tggcgcctgc aaaccagcac ccagcagggc      1260
     agcctgagcc tcgaccccgg ttttgtaaac ttccagcccg acggcagcgg caactacacc      1320
     ctgcaaagta gcagcccagc tattgacaaa ggcattaccg agcgggcccc agccatagac      1380
     ttccaggcca agccccgcct ccagggcagc gcccccgacc tgggcccctt tgaggtgcgc      1440
     tag                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page