(data stored in ACNUC7421 zone)

EMBL: CP001743.PE368

CP001743.PE368       Location/Qualifiers
FT   CDS_pept        complement(355818..356090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27150"
FT                   /protein_id="ADD27150.1"
FT                   /translation="MESARPYLLKMHTPTNPLKRFEEAPPKSREALLKLWAALGPRVRT
FT                   ADPTRYYAVQEALELDIPFPVLVLYVFRECRRALEDNPIQERLAE"
     atggagtccg cccggcccta cctgttgaaa atgcacacgc ccaccaaccc gctcaaacgc        60
     ttcgaggaag ccccgccaaa gagccgcgaa gccttgctca agctatgggc cgcgctgggg       120
     ccccgcgtgc gtaccgccga ccccacacgc tactacgctg tgcaggaggc gctcgagctc       180
     gatataccct tcccggtgtt ggtgctgtac gtgtttcgcg aatgccgccg ggccctggaa       240
     gacaacccca tacaagagcg cctggccgag tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page