(data stored in ACNUC7421 zone)

EMBL: CP001743.PE37

CP001743.PE37        Location/Qualifiers
FT   CDS_pept        32316..33224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0038"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; SPTR: A6C767 NosX
FT                   protein, putative; InterPro IPR003374; COGs: COG1477
FT                   Membrane-associated lipoprotein involved in thiamine
FT                   biosynthesis; KEGG: sus:Acid_5642 ApbE family lipoprotein;
FT                   PFAM: ApbE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26819"
FT                   /protein_id="ADD26819.1"
FT                   /translation="MPLALFKPRPYRHQAHYEGVLGTTLTLQVRARGSQQARAAEAAVL
FT                   AEIDRLERIFSSFSPESEFARWQAQGVAQLSPELQALLRAAEGWMAHTHGAFNPAAAAI
FT                   QALYRQNPEPAEGELEALRRALQGPLWRLEGRTAHKLTALPLTLNALAKGHIADRAAQA
FT                   AVAQGAEEVLLNLGGEIRHIGSQPVRVAVANPWAGADNALPLARLTICSQGVATSGRSQ
FT                   RGAHLFDPRTARPATQVVQATVVAPDAATADVLATAFCVLEPMLSLALAEVFGVGCLLV
FT                   EANGRTHTNPRFAQEETEVTR"
     atgccgctgg ccctgttcaa accgcgcccg taccggcacc aggcccacta cgagggggtg        60
     ctgggcacga ccctgaccct tcaggtgcgc gcccggggtt cgcagcaagc ccgcgccgcc       120
     gaggccgccg ttctggctga gatcgatcgc ctcgagcgca tcttcagtag cttttcgccc       180
     gaatccgagt tcgcgcgctg gcaggcccag ggcgtagccc agctttcgcc cgagctccag       240
     gccttgctgc gcgccgccga gggctggatg gcccacaccc acggggcctt taacccggcg       300
     gctgcggcca tccaggcttt atacaggcaa aaccccgagc ccgccgaggg cgaactcgag       360
     gccctgcgcc gggccctcca gggccccttg tggcggctgg agggccgcac ggcccacaag       420
     ctcaccgcgc tgcccctcac cctcaacgcc ctggccaaag ggcatatcgc cgaccgcgcg       480
     gcccaggccg cggtggccca gggggccgaa gaggtgctgc tcaacctggg cggggagatc       540
     cggcatatcg ggtcgcagcc ggtgcgggtt gcggtggcca acccctgggc tggggccgac       600
     aacgccctgc cgctggcccg cctcacgatc tgcagccagg gggtggccac cagcgggcgc       660
     tcgcagcggg gagcgcatct gttcgacccc cgcacggccc ggcctgccac ccaggtggtg       720
     caggccacgg tggtggcccc agacgcggcc accgccgatg tgctggccac ggctttctgt       780
     gtgctcgagc ccatgctcag cctggccctg gccgaggtat ttggggtggg ctgcttattg       840
     gtggaggcca acgggcgcac ccacaccaac ccccgctttg cacaagaaga aaccgaggtg       900
     acccgatga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page