(data stored in ACNUC7421 zone)

EMBL: CP001743.PE370

CP001743.PE370       Location/Qualifiers
FT   CDS_pept        complement(357044..357634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0375"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; SPTR: A4AEI3
FT                   Transcriptional regulator, Crp/Fnr family protein; KEGG:
FT                   scl:sce3757 CRP family global nitrogen regulatory protein;
FT                   COGs: COG0664 cAMP-binding protein - catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase; InterPro IPR001808:IPR000595:IPR012318; PFAM:
FT                   Bacterial regulatory proteins, crp family; Cyclic
FT                   nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27152"
FT                   /protein_id="ADD27152.1"
FT                   /translation="MKKVRRKEVIYRAGDRADALYHLERGLVRIIEILPDGRQLTLRHV
FT                   LPGDYFGEEVLSERQYKYTAEALTDAAAFAVDPQTLSSDDLRALAASLASQMAQVQAYE
FT                   THLQWGELRSRICRYLLYLAATAAQGQDERGIYVTASHEEIADATASTRESVSKLLSDL
FT                   RHEGILDTGYRKIYLVDRKTLELEAESRMLQAV"
     atgaaaaagg tacgaaggaa agaagtgatc tatcgggcgg gcgaccgtgc ggacgcgctg        60
     taccacctcg agcgtggcct ggtgcgcatc atcgagattc tgcccgacgg tcgccagctc       120
     accttgcgcc acgttctgcc cggcgactat ttcggcgagg aggtgctttc cgagcggcag       180
     tacaagtaca ccgccgaagc cctcaccgat gcagcggctt ttgctgttga cccccaaacc       240
     ctctccagcg acgacctgcg ggccctggcc gccagcctgg ccagccagat ggcccaggta       300
     caggcctacg aaacccacct gcagtggggg gagctccgca gccgtatctg ccgctatctg       360
     ctctacctgg ctgccaccgc tgcccagggg caggacgagc ggggaatcta cgtcaccgcc       420
     agccatgaag agattgccga tgccaccgct tccacccgcg agtcggtgag caaactgctc       480
     tccgacctgc gccacgaagg catcctggat accggctacc gcaaaattta tctggtagac       540
     cgcaaaaccc tggagctgga agctgaaagc cggatgctgc aagcggtctg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page