(data stored in ACNUC7421 zone)

EMBL: CP001743.PE377

CP001743.PE377       Location/Qualifiers
FT   CDS_pept        362480..363673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0382"
FT                   /product="Lycopene beta and epsilon cyclase"
FT                   /note="PFAM: Lycopene beta and epsilon cyclase; FAD
FT                   dependent oxidoreductase; SPTR: A4BXN5 Putative lycopene
FT                   cyclase; InterPro IPR006076:IPR008671; COGs: COG0644
FT                   Dehydrogenase (flavoprotein); KEGG: pub:SAR11_0122 lycopene
FT                   cyclase; PFAM: FAD dependent oxidoreductase; TIGRFAM:
FT                   lycopene cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27159"
FT                   /protein_id="ADD27159.1"
FT                   /translation="MSAAYDYDYIIVGAGAAGLSLAYHLVQAGLHDRRILLLERAPKTL
FT                   NDRTWCFWEVGEGPFEPVVFRRWNRIWFYGEGLSERLEIAPYAYKMIRGLDFYNFMHRW
FT                   MAKQPNVRLHYGEVTRLEEAPQGVRVEAGGQVFTGRWAFSSLYQPAPRQPGYHYLLQHF
FT                   KGWVVRTPRPAFDTGAATFMDFRVPQEGAVRFAYVLPFDARTALVEYTLFSPELLPPDA
FT                   YDAGLRAYLEGPLGLAQYEVLETEFGVIPMTDAPFARRPSPHVMNIGTAGGCTKASTGY
FT                   TFRRIQQQARRIAEALAQTGQPFFPEPTFNRYAYMDSVLLNVLAHRRSPGKQVFSDLFR
FT                   KNPPQRVLRFLDEKTSLLEDLQIMSSVDIPAFLRAALAVGRSRWPLARSGRMEPRRG"
     gtgagcgcgg cttacgacta cgactacatc attgtggggg ccggggcggc gggcctgagc        60
     ctggcctacc atctggtgca ggcgggattg cacgacaggc gcatcctgct gctcgagcgg       120
     gcccccaaaa ccctcaacga ccgcacctgg tgcttctggg aggtggggga gggccccttc       180
     gagccggtgg tcttccgccg gtggaaccgc atctggtttt atggggaagg cctctcggag       240
     cggctcgaga tcgcgcccta tgcctacaag atgatccgcg gcctggattt ctataacttc       300
     atgcaccgct ggatggcaaa gcagcccaac gtccgcctgc actacgggga agtcacccgc       360
     ctcgaggagg ccccgcaagg ggtgcgggtc gaggcgggtg ggcaggtatt tacgggccgc       420
     tgggccttca gcagcctgta ccagcccgcg ccccggcaac ccggctacca ctacctgttg       480
     cagcacttca agggctgggt ggtgcgaacc ccccggccgg ccttcgatac cggggccgcg       540
     acctttatgg actttcgggt tccccaggag ggcgcggtgc gttttgccta tgtcctgccc       600
     ttcgatgccc ggacggcgct ggtggagtac accctcttct cgcccgagct gctgcccccc       660
     gacgcctacg atgcagggct gcgggcctac ctcgagggcc ctttgggcct ggcgcagtac       720
     gaggtgctcg agaccgagtt cggcgtcatc cccatgaccg acgcgccctt tgcccgccgg       780
     ccaagccccc acgtcatgaa catcggcacc gccggcggct gcaccaaggc ctctaccggc       840
     tataccttcc ggcgcatcca gcagcaggcg cgccgcattg ccgaagccct tgcccagacc       900
     ggccagccct tctttccaga gccgaccttc aaccggtacg cctacatgga cagcgtgctc       960
     ctgaacgtgc tggcacaccg ccgcagtccg ggtaaacagg tcttcagcga cctgttccgc      1020
     aaaaaccccc cccagcgggt gctgcgcttt ttggacgaaa aaaccagcct gctggaagat      1080
     ttgcagatta tgtccagtgt ggacattccg gcattcctga gggctgcgct ggcagtagga      1140
     aggtcgcgct ggcccctggc gaggtcgggc cgaatggaac ccaggcgagg gtag            1194
//

If you have problems or comments...

PBIL Back to PBIL home page