(data stored in ACNUC7421 zone)

EMBL: CP001743.PE378

CP001743.PE378       Location/Qualifiers
FT   CDS_pept        363805..364839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0383"
FT                   /product="protein of unknown function DUF422"
FT                   /note="PFAM: protein of unknown function DUF422; SPTR:
FT                   A0ZKY3 Putative uncharacterized protein; InterPro
FT                   IPR007354; COGs: COG2324 membrane protein; KEGG:
FT                   afw:Anae109_4078 membrane protein-like protein; PFAM:
FT                   Protein of unknown function (DUF422)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27160"
FT                   /protein_id="ADD27160.1"
FT                   /translation="MGLALLGAVLLVWGWGGLLGAALAGWGCVLALLAVWGGDLLWAGR
FT                   RVWLVAGGAAALLAGGVGWLFYQSPALGVWALLAATATAQALWLMAQPQARARLGGLRR
FT                   HLQPWMLPLALAVLVRIPVPLWPEGFPLISLVQMLLISLAALLWGWGRVGVRIVLLAVL
FT                   AFALGLGVELLGSQTGFPFGLYSYQGAPQPTIGGVPLIVPLGWFALVLSAHVLAGGRPW
FT                   RTGLLVVAWDLGLEALMPAQGYWAWQDPNPLWYGAPIQNYLAWFAVGYAISWMYRRLGP
FT                   RLHQDGAFAWAYRLEALFLPVGLALLGLWPAALLCGLAMNGLAWLEYLPLGGCGGLKRS
FT                   RGQT"
     atgggcctgg ccctgctggg tgcggtgttg ctggtgtggg ggtggggcgg gctgctgggg        60
     gccgcgctgg ccgggtgggg ttgtgtgctg gccttgctgg cggtgtgggg cggcgatctg       120
     ctctgggcag gccgcagggt ttggctggtt gcgggcgggg ccgctgcgct gctggcgggg       180
     ggggtgggct ggctgttcta tcaatcccct gcgctggggg tctgggcctt gctggcggcc       240
     acggccaccg cccaggccct ctggctcatg gcgcagcccc aagcccgggc ccggcttggc       300
     gggctccggc ggcacctgca accctggatg ctgccgctgg ccctggcggt gctggtgcgc       360
     atcccggtgc cgctctggcc ggagggcttt cccctcatca gcctggtgca gatgctactc       420
     atcagcctgg cggctttgct ctggggctgg gggcgggtgg gggtgcgaat tgtgctgctg       480
     gcggttctgg cttttgcgct ggggctgggg gtggagctgc tgggcagcca gaccggcttt       540
     ccctttgggc tttacagcta ccagggtgcg ccgcagccca ccattggggg cgtgcccctg       600
     atcgtgccgc tgggctggtt tgccctggtg ctctcggccc atgtgctggc gggggggcgg       660
     ccctggcgca ccggcttgct ggtggtggcc tgggacctgg ggctcgaggc cctgatgccc       720
     gcccagggtt actgggcctg gcaagacccc aaccccctgt ggtacggcgc gcccatccag       780
     aactacctgg cctggtttgc ggtgggttat gccatctcct ggatgtaccg acggctgggg       840
     ccccgcctgc accaggacgg tgcttttgcc tgggcctacc ggctcgaggc cctgttttta       900
     ccggtggggc tggccctgct gggcctgtgg ccggcggcgc tgctttgtgg cctggccatg       960
     aacgggctgg cgtggctgga atacctgcct cttggggggt gtggcggcct gaaacggtct      1020
     agagggcaga catga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page