(data stored in ACNUC7421 zone)

EMBL: CP001743.PE38

CP001743.PE38        Location/Qualifiers
FT   CDS_pept        33221..33757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0039"
FT                   /product="periplasmic protein"
FT                   /note="SPTR: A6C767 NosX protein, putative; InterPro
FT                   IPR006311; COGs: COG3656 periplasmic protein; KEGG:
FT                   sus:Acid_5642 ApbE family lipoprotein; PFAM: Predicted
FT                   periplasmic protein (DUF2271)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26820"
FT                   /protein_id="ADD26820.1"
FT                   /translation="MKRSLISRRNFIHRSIGLVLTLWAGQSLAQTRWAGMKLDITFEFV
FT                   GNGFRYRPPYVAVWLEDAQGLPVRTLAVWFEQSRKGPRWLNELRRWYRSNEPTEAVSGP
FT                   TRMPGRYTLSWDGKDDKGNLVNQGDYYVCVELVREHGPYELFREKVILAQTPFKRSYNV
FT                   AGELKEVSLSYDRQG"
     atgaagcgtt ccttgatcag ccgtcgaaac tttatacacc gcagcattgg cctggtgctt        60
     accctgtggg ccggccaaag cctggcccag actcgctggg ccggcatgaa gctggacatt       120
     accttcgagt ttgtggggaa cggttttcgc taccgcccgc cctatgtggc ggtctggctc       180
     gaggacgccc agggcctgcc ggtgcgcacc ctggcggtct ggtttgagca gtcccgcaag       240
     ggcccgcgct ggctcaacga actccggcgc tggtaccgca gcaatgagcc caccgaggcc       300
     gtctcgggcc ccacccggat gccggggcgc tacaccctga gctgggacgg caaggacgac       360
     aagggcaacc tggttaatca gggtgactat tacgtgtgcg ttgagctggt gcgcgagcat       420
     ggcccctacg agctgttccg cgaaaaagtc atcctggccc agaccccctt caagcgcagc       480
     tacaacgtgg ccggcgagct taaggaggtg agcctttcct atgaccggca gggttag          537
//

If you have problems or comments...

PBIL Back to PBIL home page