(data stored in ACNUC7421 zone)

EMBL: CP001743.PE380

CP001743.PE380       Location/Qualifiers
FT   CDS_pept        365530..366618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0385"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; SPTR: A4CTP8
FT                   Putative glycosyltransferase family 2; InterPro IPR001173;
FT                   COGs: COG1215 Glycosyltransferase probably involved in cell
FT                   wall biogenesis; KEGG: met:M446_3158 glycosyl transferase
FT                   family protein; PFAM: Glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27162"
FT                   /protein_id="ADD27162.1"
FT                   /translation="MVSILEVLWYGVLAWLGLKLLVLLLNMLFFPVLKREKLRGPRPTV
FT                   SLLVPARNEAHNLRETLPGLLLQGVQEILVLNDHSTDATAQVVEEFSRQDARVRLLAGL
FT                   PKPEGWMGKTWACYQLAQAAQGEVLIFTDADVHWHKRGVRAVLARMERERAGLVSVYPR
FT                   QMTHSLAERVILPLIDDVLLCYLPYPLLRTPFPSASAANGQVMAFTRPAYLASGGHAAV
FT                   RGEVLEDVRLAQKTKGAGQRLALALGGGLVAVRMYRGFAEIVEGLGKNLIEFHGRSRVV
FT                   LALSYMGHLLAYTLCWPLALFNPLWLWVGVLGLLERLLLGLKTGRAWWELVLVPLAPLL
FT                   STPIYWRSAQRKYTWKGREYSR"
     atggtatcta tcctcgaggt gctctggtat ggggtgctgg cctggctggg ccttaagctt        60
     ctggtactgc tactgaacat gctcttcttc ccggtcttaa agcgggagaa actgcgcggg       120
     ccgcgcccca cggtctcgct gctggtgccg gcccgcaacg aggcccacaa cctgcgggaa       180
     accctgccgg gcctgctgct gcagggggtg caggaaattc tggtgctgaa cgaccattcc       240
     accgatgcga ccgcccaggt ggtcgaggaa tttagccgcc aggacgcccg cgtgcgcttg       300
     cttgcgggcc tgcccaaacc cgagggctgg atgggcaaga cctgggcctg ctaccagctg       360
     gcccaggcgg cccagggcga ggtgctcatc ttcaccgatg ccgatgtgca ctggcacaag       420
     cgcggggtgc gggcggtgct ggcccggatg gagcgcgagc gggccgggct ggtctcggtg       480
     tatccgcgcc agatgaccca cagcctggcc gaacgggtga tcctgcccct gattgacgat       540
     gtgctgctgt gctacctgcc ctaccccctg ctccgaaccc cctttccttc ggcgtcggcg       600
     gccaatgggc aggtgatggc ctttacccgg ccggcctacc tggcctcggg ggggcacgct       660
     gcggtgcggg gggaggtgct ggaggacgtg cgcctggcgc aaaaaaccaa gggcgcgggg       720
     cagcgcctgg ccctggccct ggggggcggc ctggtggcgg tgcggatgta ccggggcttt       780
     gccgagattg tggagggcct gggcaagaac ctgatcgagt ttcacgggcg cagccgggtg       840
     gttctggccc tctcgtacat ggggcacctg ctggcctata ccctgtgctg gccgctggcc       900
     ctgttcaatc cgctgtggct ttgggtgggg gtgctggggc ttttagagcg cctgctgctg       960
     ggcctcaaaa ccgggcgggc gtggtgggag ttggtgctgg tgccgctggc gcccttgctc      1020
     agcacgccca tctattggcg ttctgcgcaa cgaaaatata cctggaaagg gcgagaatat      1080
     agccgatga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page