(data stored in ACNUC7421 zone)

EMBL: CP001743.PE383

CP001743.PE383       Location/Qualifiers
FT   CDS_pept        complement(369084..369647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0388"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; SPTR: A8CRT4
FT                   GCN5-related N-acetyltransferase; InterPro IPR000182; COGs:
FT                   COG1670 Acetyltransferase including N-acetylase of
FT                   ribosomal protein; KEGG: bca:BCE_2976 acetyltransferase;
FT                   PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27165"
FT                   /protein_id="ADD27165.1"
FT                   /translation="MTLSNTWPRHGKVTLKPFTEALTETEWRRFYECFRDPEIAEWNGS
FT                   RPLRMPLWLFKRVVMGEVSRGDRMGFGILDENGEWLGTVELYEMSRTEATLGILIGAKD
FT                   RWGQGYGTDAVRAVLEYAFCTLRLQKVRLRTYKHNLRAQRAFQKAGFRYLEPPPAPTPR
FT                   FNFGLAPKAEFVPMEITREDWTCY"
     gtgacgctca gcaacacctg gcctcgccac ggcaaagtga ccctcaaacc ctttaccgaa        60
     gccctcaccg agaccgagtg gcggcgcttt tacgagtgtt ttcgtgatcc ggagattgcc       120
     gagtggaacg gaagccgtcc actcaggatg cccctgtggc ttttcaagcg ggtggtgatg       180
     ggtgaggtca gccggggcga tcggatgggg tttggcatcc tggacgagaa cggggagtgg       240
     ctgggcacgg tagagcttta cgagatgagc cgcaccgagg ccaccctggg catcctgatt       300
     ggcgccaaag atcgttgggg acagggctac ggcaccgatg cggttcgggc agtgctcgag       360
     tacgccttct gcaccctgcg gctgcaaaag gtcaggctgc gcacctacaa acacaacctt       420
     cgagcccaac gagccttcca gaaggccggc tttcgctacc tcgagccccc acccgccccg       480
     accccccgct tcaatttcgg cctggctccc aaggctgagt ttgtgcccat ggagattacc       540
     agggaagact ggacgtgcta ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page