(data stored in ACNUC7421 zone)

EMBL: CP001743.PE386

CP001743.PE386       Location/Qualifiers
FT   CDS_pept        372469..372828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0391"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; SPTR: A6ZII7
FT                   Acyl-CoA thioesterase; InterPro IPR006683; COGs: COG1607
FT                   Acyl-CoA hydrolase; KEGG: rpt:Rpal_2645 thioesterase
FT                   superfamily protein; PFAM: Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27168"
FT                   /protein_id="ADD27168.1"
FT                   /translation="MSEARTLELVFPEHANPGGNAFGGFVLGLMDKVGSYAAIRHARKR
FT                   CVTVRVGEVVFEVPIKVGDLLEVVAKVVRVGRTSLTVEVEVYRENLREPKVLATKGNLT
FT                   YVAVDEHGKPTPVEG"
     atgagcgaag cccgcaccct ggaattggtt tttcccgagc acgccaaccc cggcggcaat        60
     gcttttggcg gttttgttct gggtctgatg gataaggtgg gctcctatgc agccatccgc       120
     cacgcccgca agcgctgcgt gacggtgcgg gtgggcgagg tggtgttcga ggtgcccatt       180
     aaggtaggcg acctgctgga ggtggtggcc aaagtcgtgc gggtcggtcg cacctcgctc       240
     acggtcgagg tcgaggtgta ccgcgagaac ctacgcgagc ccaaggtgct ggctaccaaa       300
     ggcaacctca cctatgtggc ggtggacgag catggcaagc ccacacccgt cgaggggtag       360
//

If you have problems or comments...

PBIL Back to PBIL home page