(data stored in ACNUC7421 zone)

EMBL: CP001743.PE389

CP001743.PE389       Location/Qualifiers
FT   CDS_pept        complement(374242..374883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0394"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; SPTR: Q5SHS3 Redox-sensing transcriptional
FT                   repressor rex; InterPro IPR009718:IPR003781; COGs: COG2344
FT                   AT-rich DNA-binding protein; KEGG: dvl:Dvul_2068
FT                   redox-sensing transcriptional repressor REX; PFAM: CoA
FT                   binding domain; Putative DNA-binding protein N-terminus"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27171"
FT                   /protein_id="ADD27171.1"
FT                   /translation="MAKVPSAAISRLVTYLRILEDLEARGINRTSSEQLAEEAQVTAFQ
FT                   VRKDLSYFGSYGTRGVGYTVQVLRRELRQILGLNRRWGLCIVGMGRLGQAIADYPGFSE
FT                   IFELRGLFDRDPSKITTTFRGLQVESMDNLPRAIAERRIEFGLLAVPADSAQAVADRLV
FT                   ESGIKGILNFAPAVLEVPKEVAVENVDFLTGLSRLSFFVLNPKWREEMIG"
     atggctaaag tacccagtgc ggccatctcc cgcctggtca cttatctgcg gattttggaa        60
     gacctcgagg cccgggggat caaccgcacc tcctccgaac aactggccga ggaggcccag       120
     gtcaccgcct ttcaggtgcg caaagacctc tcgtacttcg gcagctacgg cacgcggggg       180
     gtgggctaca cggtgcaggt tttgcgccgg gagctccggc aaattctggg cctgaaccgc       240
     cgctggggcc tctgcattgt gggcatgggc cgcctgggcc aggccatcgc cgactacccc       300
     ggcttcagcg agatcttcga gctaaggggc ctgttcgacc gcgacccctc caaaattacc       360
     accaccttcc ggggtttgca ggtcgaaagc atggataacc tgccgcgggc catagccgaa       420
     aggcgcatcg aattcggcct tctggcggtt cctgcagatt cggcccaggc agtggccgat       480
     cgtctggtag agtcaggtat caagggcatc ctgaacttcg ctccagcagt tctggaggtg       540
     cccaaggaag tcgcggtgga gaacgtagat tttctcaccg gactgagcag gctctcgttc       600
     ttcgtcttaa accccaaatg gagagaggag atgatcggat ga                          642
//

If you have problems or comments...

PBIL Back to PBIL home page