(data stored in ACNUC7421 zone)

EMBL: CP001743.PE390

CP001743.PE390       Location/Qualifiers
FT   CDS_pept        complement(374906..375340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0395"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; InterPro
FT                   IPR007730; KEGG: azo:azo1051 hypothetical protein; PFAM:
FT                   Sporulation related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27172"
FT                   /protein_id="ADD27172.1"
FT                   /translation="MVVGAFGDRENAERLTTTLRQQGYPVGLEAAGNLTRVWVGPYSTQ
FT                   DRARAVAGTLEQYQPQVGRVPTPTPRAETTPEAGRYLQVGAFRKAQSAQAVIEAVRQAG
FT                   YPVVLVEEGGLVKVRVGPLEDTTAAATDLRARGLEVLEVR"
     gtggtggtgg gcgcctttgg cgaccgcgaa aacgccgaac gcctgaccac aaccctgcgc        60
     cagcagggat acccggtggg cctcgaggcc gccggcaacc tcacccgggt ctgggtgggc       120
     ccttacagca cccaggatcg ggcccgcgcc gttgctggca ccctcgagca gtaccagccc       180
     caggtgggcc gggttccgac ccctacaccc cgcgcagaaa ccactccaga ggctggccgc       240
     taccttcagg taggggcttt ccgcaaggcc cagagcgccc aggcggttat cgaggccgtg       300
     cggcaggccg gctacccggt ggtgctggtg gaggaaggcg gcctggtcaa ggttcgggtc       360
     ggccccctcg aggacaccac cgcggcggct accgatttgc gggcccgggg cctcgaggtt       420
     ctggaggttc gctag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page