(data stored in ACNUC7421 zone)

EMBL: CP001743.PE391

CP001743.PE391       Location/Qualifiers
FT   CDS_pept        complement(375770..377209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0396"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; Tetratricopeptide TPR_4;
FT                   Tetratricopeptide TPR_3; SMART: Tetratricopeptide domain
FT                   protein;
FT                   InterProIPR011717:IPR001440:IPR011716:IPR013105:IPR 013026;
FT                   KEGG: rpc:RPC_3120 TPR repeat-containing protein; SPTR:
FT                   A3CV42 Tetratricopeptide TPR_2 repeat protein; PFAM:
FT                   Tetratricopeptide repeat; Tetratricopeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27173"
FT                   /protein_id="ADD27173.1"
FT                   /translation="MKQLLCAALLFVSLSWAQQSQPPAIEQTLQQAQAALEAGRLNEAV
FT                   QGFEAVIARDFTNYSAHFGLGLALYRLGDLRGAAFEFTQLTVLDPNRFEGWFNLGVVRD
FT                   RQGQAAEAAEAFGKAIEVGEKAGLGLNELKPAYIGQVKALRTQGQHEAAATAARKALEK
FT                   ASGDLELTSLLADSLVKANKPLEALPVLYQILAKDPANTQAVSQIADIYMAQGLPLRAL
FT                   REIDRGLEAAKDNAVRAQLLLKKSTLQQGREQQATLQEAVRLDPKLWAAHYNLGVARLR
FT                   DGNARGALESFQNAYAQNPDEPRVLLGLATTHDRLGQAAEAARFAEMAAKASQGTDRLE
FT                   ALFLQGKSAYTLRRYSEAAELLSQVTQQKADNAEAWFFLGVAQFNLKDYAAAAESLEKA
FT                   QALAPSAATAANLGAALYSAGRYSDAERVLSQAVTLDGRNAVAWYNLGLTLRSLGRVAE
FT                   ARRAWQRSADLGYAPARDLLR"
     atgaaacaac ttttgtgcgc ggcgcttcta tttgtttcgc tgagctgggc gcaacaaagc        60
     cagcctcctg cgatagagca gaccctgcag caggcccagg ccgccctcga ggccgggcgt       120
     ctgaacgagg ccgtgcaggg ttttgaagct gtgattgctc gcgacttcac caactacagc       180
     gcgcacttcg gactggggct ggccctatac cgcctgggtg atttgcgggg ggcagccttc       240
     gagttcaccc agctcaccgt tctcgacccc aaccgctttg agggctggtt caacctgggg       300
     gtggtgcgcg accgccaggg ccaggccgcc gaggccgccg aggcctttgg caaggccatc       360
     gaggtgggcg agaaggctgg ccttggcctc aacgagctca aaccggccta tataggccag       420
     gttaaggccc tgcgcaccca gggccagcat gaggccgctg caactgctgc ccgcaaggcg       480
     ctggaaaaag cctctggcga cctcgagctg acctcgctgc tggccgatag cctggtcaaa       540
     gccaacaagc ccctcgaggc cctacccgtg ctgtaccaga ttctagccaa agacccggcc       600
     aacacccagg ccgtctcgca gattgccgat atctacatgg cccagggcct gcccctgcgg       660
     gccctgcggg agatcgaccg agggctggag gccgccaaag acaacgccgt gcgggcccaa       720
     ttgctgctca agaaatccac cctgcagcag ggccgtgagc agcaggccac cctgcaggag       780
     gccgtccgcc tcgaccccaa actgtgggcg gcgcactaca acctgggtgt ggcccgcctg       840
     cgcgatggca acgcccgggg ggcgctggag tccttccaga acgcctatgc ccagaacccc       900
     gacgagccca gggtgctgct gggtttggcc accacccacg accgcctggg ccaggccgct       960
     gaagccgccc gcttcgccga aatggccgcc aaagccagcc agggtaccga ccggctcgag      1020
     gccctgttcc tgcaaggcaa gtctgcatac accctgcgcc gctacagcga ggcagccgag      1080
     ttgctgtcac aggtaaccca gcaaaaagcc gataacgccg aggcctggtt ctttctgggg      1140
     gttgcgcagt tcaacctgaa ggactatgcc gccgccgccg aatcgctgga aaaagcccag      1200
     gccctggccc ctagcgccgc caccgcggcc aacctcgggg ctgcgctcta ctcggcggga      1260
     aggtactccg atgccgagcg ggtgctctcc caggcggtaa ccctggatgg ccgcaacgcg      1320
     gtggcctggt acaacctggg cctcaccctg cgctcgctgg gccgcgtggc cgaagcccga      1380
     cgggcctggc agcgctccgc cgacctgggt tacgccccag cccgcgattt attgcggtag      1440
//

If you have problems or comments...

PBIL Back to PBIL home page