(data stored in ACNUC7421 zone)

EMBL: CP001743.PE394

CP001743.PE394       Location/Qualifiers
FT   CDS_pept        379451..379918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27176"
FT                   /protein_id="ADD27176.1"
FT                   /translation="MAIDLLLALVFALLAWAMALWVSAEVSLSPAQNRLQSRIHLGLTL
FT                   ATQLLYVWLVQTVGSWRDALLVISVMLALAWYAMLGLTKALRQNTTEKRSLVERLELSG
FT                   HRAFAFTALILMGAGALFALFDPTLALTIALPLGVALFCTLWVTYWVRKSA"
     atggctattg accttttgct ggccctggtg tttgcgctcc tggcctgggc catggcccta        60
     tgggtctcgg cggaggtgag cctgagcccg gcccagaacc gcctgcaaag ccgcatccac       120
     ctgggcctta cgctggcgac ccaactgctc tacgtgtggc tggtgcagac tgtgggctcc       180
     tggcgcgatg cgctgctggt gatctcggtc atgctggctt tggcctggta cgccatgctg       240
     ggcctgacca aagccctgcg ccagaacaca accgagaaga ggtcgctggt tgagcgcctc       300
     gagctctccg ggcaccgggc ctttgccttc actgccctca tcctgatggg tgctggcgcg       360
     ctttttgcgc tctttgaccc caccctggcg ctcaccatcg ccctacccct gggcgtggcc       420
     ctgttctgca ccctctgggt gacctactgg gtgcgtaaaa gcgcctag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page