(data stored in ACNUC7421 zone)

EMBL: CP001743.PE395

CP001743.PE395       Location/Qualifiers
FT   CDS_pept        complement(379922..380356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0400"
FT                   /product="Disulfide bond formation protein DsbB"
FT                   /note="PFAM: Disulphide bond formation protein DsbB; SPTR:
FT                   O32217 Disulfide bond formation protein C; InterPro
FT                   IPR003752; COGs: COG1495 Disulfide bond formation protein
FT                   DsbB; KEGG: bsu:BSU33470 thiol-disulfide oxidoreductase;
FT                   PFAM: Disulfide bond formation protein DsbB"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27177"
FT                   /protein_id="ADD27177.1"
FT                   /translation="MSPMQTQSTPLDRNALLLAFAWLVALVATLGSLYYSEVRNFIPCT
FT                   LCWYQRIAMYPLVLILGLATWRNDVHIRPYALTLSLVGLFWSSYHLLELWVPGLAPNVC
FT                   KGPIPCNVEYIPSFPIPLQAGIAFTLISLALFLLRPTRRS"
     atgagcccga tgcagaccca atccaccccg ctcgacagaa acgcgctctt actggccttt        60
     gcctggctgg tggcgctggt cgccaccctg ggcagcctct actattccga ggtgcgcaac       120
     tttatcccct gcaccctgtg ctggtaccag cgcatcgcca tgtatcccct ggtattgatc       180
     ctgggcctcg ccacctggcg caacgacgtt catatccggc cctatgccct caccctgtcg       240
     ctggtgggcc tgttctggag cagctaccac cttctggagc tatgggtgcc gggcctggcc       300
     cccaacgtct gtaaaggccc cattccctgc aacgtggagt acattcccag cttccccatc       360
     ccgctgcagg ctggtatcgc tttcacgctt atctcgctgg cgctgttttt gctgcgcccc       420
     acccggcgtt cgtag                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page