(data stored in ACNUC7421 zone)

EMBL: CP001743.PE397

CP001743.PE397       Location/Qualifiers
FT   CDS_pept        complement(380997..381914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0402"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="TIGRFAM: signal recognition particle-docking protein
FT                   FtsY; PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase; InterPro
FT                   IPR013822:IPR000897:IPR003593:IPR004390; KEGG: noc:Noc_1934
FT                   cell division transporter substrate-binding protein FtsY;
FT                   COGs: COG0552 Signal recognition particle GTPase; SPTR:
FT                   P83749 Cell division protein ftsY; PFAM: SRP54-type
FT                   protein, helical bundle domain; SRP54-type protein, GTPase
FT                   domain; TIGRFAM: signal recognition particle-docking
FT                   protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27179"
FT                   /protein_id="ADD27179.1"
FT                   /translation="MSWLQRLKEGLSKTRDNLVKAIPWGEDPEAVLEELEFALIAADVG
FT                   VEATQEVLEEVRQSGKKDLREALKQALTVQLEPDRFRAKIRKAGFNPNAKKSTVEPAGK
FT                   VILMVGVNGVGKTTTIAKLGQYYQSKGRSVMFCAGDTFRAAGGAQLGLWGERLGIPVIQ
FT                   GPEGSDPAALAFDAASARKARGLDLLLVDTAGRLHTKHNLMEELAKVKRSIAKADPGEP
FT                   GEVWLVLDAVTGQNGLEQAKKFHQTVGLTGVIVTKLDGTAKGGVLVPIVRTLGVPIKFI
FT                   GVGEKADDLQPFDAGEFVEALLGA"
     atgagttggc tgcaacgcct caaagaaggc ctgagtaaaa cccgcgacaa cctggtcaaa        60
     gccatcccct ggggcgaaga ccccgaggcg gtgttggagg agctcgagtt cgccctgatt       120
     gccgccgatg tgggggtgga ggccacccag gaagttctgg aggaggtgcg tcagtcgggc       180
     aaaaaagacc tgcgcgaggc gctaaagcag gccctcacgg tgcagctcga gcccgaccgc       240
     ttccgggcca aaatccgcaa ggcgggcttc aaccccaacg ctaaaaaatc caccgtggag       300
     cccgccggca aggtgattct gatggtgggg gtcaacgggg tgggcaagac caccaccatc       360
     gccaagctgg ggcagtacta ccagagcaag ggcagaagcg tgatgttctg cgccggcgac       420
     accttccggg ccgcgggcgg ggcccagctc gggctgtggg gggaacggct gggcatcccg       480
     gtgattcagg ggccggaggg ttccgacccc gccgccctgg ccttcgacgc ggcctcggcc       540
     cgcaaggccc ggggcctgga tctgctgctg gtggacaccg ccgggcggct gcacaccaag       600
     cacaacctga tggaggagct ggccaaggtc aagcgctcca tcgccaaggc cgaccccggc       660
     gagcccggtg aggtctggct ggtgctggac gcggtcacgg ggcagaacgg cctcgagcag       720
     gccaaaaagt tccaccagac cgtgggcctg accggggtga tcgtcaccaa gctggacggc       780
     accgccaagg ggggggtgct ggtgcccatc gtgcgtacgc tgggcgtgcc catcaagttt       840
     atcggggtgg gcgagaaagc cgacgacctg caacccttcg acgccggcga gtttgtggag       900
     gctctgctgg gcgcatga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page