(data stored in ACNUC7421 zone)

EMBL: CP001743.PE398

CP001743.PE398       Location/Qualifiers
FT   CDS_pept        381979..382929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0403"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain protein; InterPro
FT                   IPR006070:IPR005145:IPR004388; KEGG: rsq:Rsph17025_2463
FT                   SUA5/YciO/YrdC/YwlC family protein; COGs: COG0009 Putative
FT                   translation factor (SUA5); SPTR: A6C3T1 Sua5 related
FT                   protein; PFAM: yrdC domain; SUA5 domain; TIGRFAM:
FT                   Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27180"
FT                   /protein_id="ADD27180.1"
FT                   /translation="MVVPPTPENLERAAQIIRSGGLVAFPTETVYGLGANALDARAAAR
FT                   IFEAKQRPSFDPLIVHVADRGMLQKVVQEVPALAERLMERFWPGPLTLVLPRSERVPGL
FT                   VTSGLPTVAVRMPAHPVAQELIRRAGLPLAAPSANPFGYLSPTRAEHVERMLGGRVDLI
FT                   LDGGRTEFGVESTIVLLAEKPTVLRYGAVAVEELERVLGRLELQVGAREKPLVPGQLPQ
FT                   HYAPHTPIRIAPPSEIPLGLRKRVGYLAFQEVPKGFKVVKVLSPTGSLLEAAAHLFEAL
FT                   HQLDRLGLEAIYAEPIPEVGLGRAIMDRLRRASSA"
     atggttgtac cgcccacccc cgaaaacctc gagcgcgccg cccagattat ccgcagtggt        60
     gggctggtgg cttttccgac cgagaccgtt tacggcctgg gggccaatgc cctggacgcc       120
     cgggccgcgg ccagaatctt tgaggctaaa cagcgcccca gcttcgaccc actgatcgtc       180
     catgtggccg atcgggggat gctgcaaaag gtggtacagg aggttccagc gctggccgag       240
     cggctgatgg agcgcttctg gccgggcccc ctcacgctgg tgctgcccag gtcggagcgg       300
     gtgccaggcc tcgtgacctc ggggctcccg acggtggcgg tgcgcatgcc ggcccacccg       360
     gtggcccagg agctgatccg gcgggctggc ctgccgctgg ccgcgcccag cgccaatccc       420
     tttggctacc tgagccccac ccgggcggaa cacgtcgagc ggatgctggg ggggcgggtg       480
     gatctgatcc tggatggggg gcgaaccgag tttggggtag agtccaccat tgttttgcta       540
     gccgagaaac ccaccgtgct gcgctatggt gcggtggcgg tggaggagct ggagagggtg       600
     ctgggtaggc tggagctgca ggtgggggcg cgggaaaaac ccctggttcc gggccagttg       660
     ccccagcact acgcgcccca tacccccatt cgcatcgccc cgcccagcga gatacccctg       720
     ggccttcgca agcgggtggg ctacctggct tttcaggaag tgcccaaggg gttcaaggtg       780
     gttaaggtgc tgtctccaac tggcagcttg ctggaggctg ccgcccatct gtttgaagcg       840
     ctgcaccagc tcgaccggct gggcctggag gccatttacg cggagccgat ccccgaggtg       900
     gggctgggaa gggccattat ggatcggctg cgcagggcct cgagcgccta g                951
//

If you have problems or comments...

PBIL Back to PBIL home page