(data stored in ACNUC7421 zone)

EMBL: CP001743.PE399

CP001743.PE399       Location/Qualifiers
FT   CDS_pept        382971..383477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27181"
FT                   /protein_id="ADD27181.1"
FT                   /translation="MRGRNVFLLVLIVAMAVFAWRNWAVFSEEKTLSLFFTQITAPFGI
FT                   VMLTIMAVLVAIYFMYTVGLETAALLEVKRYARELLAARKLADEAEASRFSELKKWLEG
FT                   ELAGLKAQSPTGLEARLQAIAERIDRLEDELREDIEKAGNTLAAYIGELEDQITGQDRH
FT                   PPPPR"
     atgcgagggc gtaacgtttt cctactggtg ctgatcgtcg cgatggcggt attcgcctgg        60
     cgaaactggg ccgtttttag cgaggagaaa acactctcgc tcttctttac ccagatcacc       120
     gctccgttcg gcatcgtgat gcttaccatc atggcggtgc tggtggccat ttattttatg       180
     tatacggtgg ggctcgagac cgccgccctg ctcgaggtca agcgctacgc ccgcgagctg       240
     ctggccgccc gcaagctggc cgacgaggcc gaggccagcc gtttctcgga gctcaaaaag       300
     tggctcgagg gcgaactggc tggtctcaaa gcccagagcc cgacggggct cgaggccagg       360
     ttgcaggcta ttgccgagcg catagatcgg ctggaggacg aactgcgcga ggatatcgag       420
     aaggccggca ataccctggc cgcctacatc ggtgagctgg aagaccagat aaccggccag       480
     gacaggcatc cgcccccccc gcgttga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page