(data stored in ACNUC7421 zone)

EMBL: CP001743.PE4

CP001743.PE4         Location/Qualifiers
FT   CDS_pept        4406..5830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0004"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="TIGRFAM: pyruvate kinase; PRIAM: Pyruvate kinase;
FT                   PFAM: Pyruvate kinase barrel; Pyruvate kinase alpha/beta;
FT                   SPTR: A7CAK5 Pyruvate kinase; KEGG: acr:Acry_0178 pyruvate
FT                   kinase; COGs: COG0469 Pyruvate kinase; InterPro
FT                   IPR015793:IPR015794:IPR001697; PFAM: Pyruvate kinase,
FT                   alpha/beta domain; Pyruvate kinase, barrel domain; TIGRFAM:
FT                   pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26786"
FT                   /protein_id="ADD26786.1"
FT                   /translation="MGLLKRTKIVATLGPASRSPEVIRALIEAGVDVFRLNFSHGVPED
FT                   HRASVQMIREASSALGRTVAILQDLQGPKIRCGRFREGAVELQPGQKFIITAEPVEGDE
FT                   TRVSTTYRGLPNDVTPGQILLLDDGNIRLRVDEVRINDIHTTVLVGGRLSNNKGINIPG
FT                   ADLSIPALTDKDIDDIALGAELEVDWVAISFVRSRDDLLLARHYLTRHNSRARLMAKIE
FT                   KPSAVARFDEILEEADGIMVARGDLGVEMPLEEVPAVQKRIILKSVQAGKAVITATQML
FT                   ESMIKNPSPTRAEASDVANAIFDGTDAVMLSAETAAGQYPVEAVSFMTRVAKTIEATQE
FT                   YKDRLNALRPPATRTVQDAIARAVDDVVESTGAKAVVVFTSSGGAARRVARTRPPVPIL
FT                   ALTPNPHVRNQLALVSDVLPLLAPDPKDTDDMVQIAVAKAKETGLAEVGEYVVIAAGVP
FT                   FGVRGTTNMIRVERVS"
     atgggactct tgaaacgaac caaaattgtg gccaccctgg ggcccgcctc gcgttcgccc        60
     gaagtgatac gggccctgat cgaggccggc gtcgatgttt ttcgcctcaa cttttcgcat       120
     ggcgtgcccg aggaccaccg ggcctcggtg cagatgatcc gggaggcctc gagcgccctc       180
     ggccgcaccg tggccatcct gcaagacctg caaggcccca agattcgctg cgggcgcttc       240
     cgcgaggggg cggtggagct tcagccaggg caaaaattca tcatcaccgc cgagcccgtc       300
     gagggggatg aaacccgggt ctcgaccacc taccggggtc tgcccaacga tgtgacccca       360
     ggacagattc tgcttctgga tgatgggaac atccgactgc gggtggacga ggttcgcatc       420
     aacgacatcc acaccaccgt gctggtaggg gggcggcttt ccaacaacaa gggcatcaac       480
     atccccgggg ccgacctttc gatcccagcc ctgaccgata aagacatcga cgatatcgcc       540
     ctgggcgccg agctcgaggt ggactgggtg gccattagct ttgtgcgcag ccgcgacgac       600
     ctgctgctgg cccgccacta cctgacccgc cacaactccc gcgcccggct gatggctaag       660
     atcgagaagc ccagcgcggt ggcccgcttc gacgagatcc tcgaggaggc cgacggcatc       720
     atggtggccc gcggcgacct gggggtggag atgccgctgg aggaggtgcc ggcggtgcag       780
     aagcgcatca tcctcaagtc ggtgcaggct ggcaaggccg taattaccgc cacccagatg       840
     ctggagtcca tgatcaaaaa ccccagcccc acccgcgccg aggcctcgga tgtggccaac       900
     gccatcttcg acggcaccga tgcggtgatg ctttcggccg agaccgctgc gggccagtac       960
     ccggtcgagg cggtctcgtt catgacccgg gtggccaaga ccatcgaggc cacccaggag      1020
     tacaaagacc gcctcaacgc cctgcgcccg ccggccaccc gcaccgtgca ggacgccatc      1080
     gctcgagctg tggacgatgt ggtggagtcc accggggcca aggccgtggt ggtgttcacc      1140
     tccagcggcg gggcggcccg ccgggtggcc cgcacccggc ccccggtgcc gattctggcc      1200
     ctgaccccca acccccacgt gcgcaaccaa ctggccctgg tctcggacgt gctgcccctg      1260
     ctggcccccg accccaaaga caccgacgat atggtgcaga ttgcggtggc caaggccaag      1320
     gaaaccggcc tggccgaggt gggcgagtat gtggtgattg ccgccggggt gccctttggg      1380
     gtgcggggta ccaccaacat gatccgggtg gagcgggtta gctga                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page