(data stored in ACNUC7421 zone)

EMBL: CP001743.PE402

CP001743.PE402       Location/Qualifiers
FT   CDS_pept        complement(385360..386103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0407"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   InterPro IPR003439:IPR003593:IPR017871; KEGG: dal:Dalk_2887
FT                   ABC transporter related; COGs: COG1131 ABC-type multidrug
FT                   transport system ATPase component; SPTR: Q5JDA7 ABC-type
FT                   multidrug transport system, ATPase component; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27184"
FT                   /protein_id="ADD27184.1"
FT                   /translation="MIRLEDLSKRYGSFVALDGLNLEVRPGETLALLGPNGAGKSTTIK
FT                   ALVGLLRPSRGRALVGGVDVWKDPVRAKAQFGYVPDRPYLYGKLSGLELLRFAAGIYRL
FT                   PRAQAEARIEELLVQFRLERFASSLIETYSHGMRQKLSLAMSLLHAPPALILDEPMVGL
FT                   DPHATRLVKDLLREYSKNGRAVLYATHQLHLAEQVADRVALVHRGRLLALGSPKELLHQ
FT                   HGSSDLEEFFLRLTEDASESASVLA"
     atgatccggc tggaagacct cagcaagcgg tacggctctt ttgtggccct ggacggcctg        60
     aacctggaag tacggcccgg cgagaccctg gccctgctcg ggcccaacgg cgcgggcaaa       120
     agcaccacca tcaaggcgct ggtggggttg ttgcggccca gccggggccg ggccctggta       180
     gggggggtgg atgtctggaa agacccggtg cgggccaagg cccagttcgg ttacgtgccc       240
     gaccggccct acctatacgg caagctctcg ggcctcgagc tcctgcgctt tgccgctggg       300
     atctaccgcc tgcccagggc ccaggccgag gcccgcatcg aggaactgct ggtgcagttc       360
     cgcctcgagc gcttcgcttc ctcgctgatc gagacctact cgcacggcat gcggcaaaag       420
     ctctcgctgg ccatgagcct tctgcacgcc ccaccggccc tgattctgga cgagccgatg       480
     gtggggctcg acccccacgc cacccggctg gtcaaggact tgttgcgcga atattccaag       540
     aacgggcggg cggtgctcta cgccacccac cagcttcacc tggccgagca ggtcgccgac       600
     cgggtggccc tggtacaccg ggggcgtctg ctggccctgg gctcccctaa ggaactcctg       660
     caccagcacg gctcgagcga cctcgaggag ttcttcttac gcctcaccga agacgccagt       720
     gagtccgcca gcgtactggc ctag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page