(data stored in ACNUC7421 zone)

EMBL: CP001743.PE405

CP001743.PE405       Location/Qualifiers
FT   CDS_pept        388485..389036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0410"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA;
FT                   InterPro IPR003489; KEGG: bcz:BCZK4884 ribosomal subunit
FT                   interface protein; COGs: COG1544 Ribosome-associated
FT                   protein Y (PSrp-1); SPTR: Q9RVE7 Protein DR_1082; PFAM:
FT                   Sigma 54 modulation protein / S30EA ribosomal protein;
FT                   TIGRFAM: ribosomal subunit interface protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27187"
FT                   /protein_id="ADD27187.1"
FT                   /translation="MNVYKLVGRQIEITEALKNYLDKKMARLDRYFDNNVEAKVVLSMA
FT                   QGPRIERKAKAEIQVNVPGGIVRVEEADPDMYAAIDRSIDRLEYQLKRYKERHFQRARH
FT                   AVPEAVLAGSAHLETEEEAEPRIVRTKRFHMKPMTPEDAAFEMEALGHDFFVFRNADTE
FT                   QINVIYRRRDGNYGLIEPTA"
     atgaacgttt acaaactggt tggtcgccaa attgagatca ccgaggccct caagaactac        60
     ctggacaaga agatggcccg cctggatcgc tactttgata acaacgttga ggccaaagtg       120
     gtgctctcga tggcccaggg cccgcgcatc gagcgcaagg ccaaggccga gattcaggtc       180
     aatgtgccgg ggggtattgt gcgggtggag gaggccgacc ccgatatgta cgcggccatt       240
     gatcgctcga ttgaccgcct cgagtaccag ctcaagcgtt acaaagaacg ccactttcag       300
     cgcgcgcgcc atgcggttcc agaagctgtt ctggctggaa gcgcccacct cgaaaccgag       360
     gaagaggccg agccccgcat cgtgcgtacc aaacgctttc acatgaagcc catgaccccg       420
     gaagatgccg ccttcgagat ggaagcccta ggccacgact tctttgtttt ccgcaacgcc       480
     gataccgagc agattaacgt gatttatcgg cgtcgtgacg gcaattatgg cctgattgag       540
     cccaccgcct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page