(data stored in ACNUC7421 zone)

EMBL: CP001743.PE407

CP001743.PE407       Location/Qualifiers
FT   CDS_pept        complement(389704..390864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0412"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; SPTR: A7CZ85
FT                   Aminotransferase class I and II; InterPro IPR004839; COGs:
FT                   COG1168 Bifunctional PLP-dependent enzyme with
FT                   beta-cystathionase and maltose regulon repressor
FT                   activities; KEGG: csa:Csal_3036 aminotransferase, class I
FT                   and II; PFAM: Aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27189"
FT                   /protein_id="ADD27189.1"
FT                   /translation="MQLDELSPRTLRDPYGYSGKWHFYPADVLPMWVADMDFPISPAIT
FT                   QAIVERLQERVGYPQMKGDGLLLERIIQQQSQFGLEGLTPENLLLTTSVVPAIYASVLA
FT                   LSSPGDEVITQVPVYPPFLNALSEHHRIARHNPLQPTPSGWEIDFDQLERLVTPRTRLL
FT                   LLCNPQNPTGRVFRRDELERLAEFALRHRLWVMSDELWADLIYEGQHIPIASLSPEIAQ
FT                   RTVTLTGPCKSYNTAGLGGGVAISHNKQILSAMAQVSKGLGGHPNVLAMAAWRAALEHA
FT                   QDWLQQVRAYLKGNRDLVTGFMQQRLPQVGYRPPQGTYLAWLDFSQTPLAQEAHKIMLE
FT                   QAKVGLNDGRMFGPQYQGWLRLNFATSRSLVQEALERIARVVQAVD"
     atgcaattgg acgagctatc gccccgcacc ctgcgcgatc cctacggcta cagcggcaag        60
     tggcactttt accctgcgga cgtactgccc atgtgggtgg ccgacatgga cttccccatc       120
     agcccggcca tcacccaggc cattgtagag cggctgcagg agcgggtggg ctatccccag       180
     atgaaagggg atgggctgct gctggaacgc attattcagc agcaaagcca gttcggtctg       240
     gagggtctta cccccgaaaa cctgctgctc accacctcgg tggtgccggc catctacgcc       300
     agcgtgctgg ccctgagcag ccccggcgat gaggtgatca cccaggtgcc ggtctatcct       360
     ccgtttctca acgccctcag cgagcaccac cgcatcgccc ggcacaaccc gctgcaaccc       420
     acccccagcg gctgggagat tgactttgat cagctcgagc gcctggtgac cccccgcacc       480
     cggctactgc tgctgtgcaa cccccagaac cccaccgggc gggtcttccg acgtgacgag       540
     ctggagcgac tggccgagtt tgccctgcgc caccgcctgt gggtgatgtc cgacgaactc       600
     tgggccgacc tgatttacga gggccagcac atccccattg cctctttgag ccccgagatt       660
     gcccagcgca ccgtgaccct caccgggccc tgcaagtcgt acaacaccgc cgggctgggc       720
     ggcggggtgg ccatcagcca caacaagcag atcctgagcg ccatggccca ggttagcaag       780
     ggccttgggg gccaccccaa cgtgctcgcc atggcagcct ggcgggctgc gctcgagcac       840
     gcccaggact ggctacagca ggtgcgggcc tacctgaagg gcaaccgcga cctcgtcacc       900
     gggtttatgc agcagcgcct accccaggtg ggctaccggc ccccgcaagg cacctacctg       960
     gcctggctgg acttctcaca aacgcccctg gcccaggagg cgcacaagat catgctggaa      1020
     caggccaaag tcggcctcaa cgatggcagg atgttcgggc cgcagtacca gggctggctg      1080
     cgtctaaact ttgcgaccag ccgctcgctc gtgcaagagg cgctcgagcg cattgcacgg      1140
     gtagtccagg cggtcgatta g                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page