(data stored in ACNUC7421 zone)

EMBL: CP001743.PE411

CP001743.PE411       Location/Qualifiers
FT   CDS_pept        393643..394725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0416"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   SPTR: A3IP83 Extracellular solute-binding protein; InterPro
FT                   IPR004682:IPR006311; COGs: COG4663 TRAP-type
FT                   mannitol/chloroaromatic compound transport system
FT                   periplasmic component; KEGG: xau:Xaut_3328 TRAP
FT                   dicarboxylate transporter-DctP subunit; PFAM: Bacterial
FT                   extracellular solute-binding protein, family 7; TIGRFAM:
FT                   Tat (twin-arginine translocation) pathway signal sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27193"
FT                   /protein_id="ADD27193.1"
FT                   /translation="MKRRDFLKKAGVGAVAASTVFGPVYAQTLPRLRWRMATSWPRSLD
FT                   TLFGAAEIVARRVAEMTDGRFEITPYPAGEIAPGLQVLDVVQAGNVEMGHTANYYYVGK
FT                   SPSLAFDTGVPFGLNPRQQNAWLYFGGGLQAMQRVAADFNVITFPAGNTGVQMGGWFRR
FT                   EIRGPEDLRGLRFRIPGLGGQVMARLGVTVQTLAAGEIFLALDRGAIDAAEFVGPYDDE
FT                   KLGLNKAARFYYYPGWWEPGSTVSTLINLERWRSLPKEYQEIVKAACAEANDRTIAEYD
FT                   AKNAPALARLQRAGTQLRPYPSSVLQAANREATALYEEIAAKDTTYRGIYENWKKFRDE
FT                   SRRWFALNEFRYDDFVRTLR"
     atgaagcgac gtgacttctt gaagaaggcg ggggtcggtg ccgtagcggc gagcaccgtg        60
     tttggcccgg tctatgccca gaccctgccg cgtttgcgct ggcgtatggc cacgagctgg       120
     ccccgctcgc tggataccct gtttggcgct gccgagattg tggccaggcg ggtggccgag       180
     atgaccgatg gccggttcga gatcaccccc tatccggcgg gtgagattgc tcccgggctg       240
     caggtgctgg atgtggtgca ggccggcaac gttgagatgg gccatacggc taactattac       300
     tacgtgggca aaagcccctc gctggccttc gataccgggg taccctttgg cctgaaccct       360
     cgccagcaaa acgcctggct ctactttggc ggtgggttgc aggccatgca gcgggtggcc       420
     gccgacttca acgtcatcac cttcccggca ggtaacaccg gggtgcagat gggcggctgg       480
     ttccgcaggg aaatccgggg ccctgaagac ctcagggggc tgcgcttccg cattccaggc       540
     ctaggggggc aggttatggc ccgcctgggg gttacggtgc aaaccctggc ggctggggag       600
     atcttcctgg cgctcgaccg tggcgctatc gacgcagccg agtttgtagg cccctacgat       660
     gacgaaaaac tcggtctgaa caaggcggcc cgcttctact actaccccgg ctggtgggaa       720
     cccggttcga cagtttccac tctgatcaac ctcgagcgct ggcgcagcct gcccaaggag       780
     taccaggaga ttgtcaaggc ggcctgcgcc gaggccaacg atcgaaccat agccgaatac       840
     gatgccaaaa acgccccggc gctggcccgg ttgcagcggg ctggcaccca gcttagaccc       900
     tatccttcca gcgtgctgca ggcggccaac agagaggcca ccgctttgta cgaagaaatt       960
     gccgccaaag ataccaccta ccgtggcatc tacgagaact ggaagaaatt ccgcgacgag      1020
     tcccgccgct ggtttgcgct taacgagttc cgctacgatg attttgtccg caccttgcgg      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page