(data stored in ACNUC7421 zone)
EMBL: CP001743.PE412
CP001743.PE412 Location/Qualifiers
FT CDS_pept 394865..395422
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="Mrub_0417"
FT /product="Tripartite ATP-independent periplasmic
FT transporter DctQ component"
FT /note="PFAM: Tripartite ATP-independent periplasmic
FT transporter DctQ component; SPTR: A0YPZ6 Tripartite
FT ATP-independent periplasmic transporter, DctQ component;
FT InterPro IPR007387; COGs: COG4665 TRAP-type
FT mannitol/chloroaromatic compound transport system small
FT permease component; KEGG: tbd:Tbd_2150 TRAP transporter,
FT small subunit; PFAM: Tripartite ATP-independent periplasmic
FT transporters, DctQ component"
FT /db_xref="EnsemblGenomes-Gn:Mrub_0417"
FT /db_xref="EnsemblGenomes-Tr:ADD27194"
FT /protein_id="ADD27194.1"
FT /translation="MKALLLIARLIDGLNEWVGRVTLWLVVPMIAIGAYNAIGRSLDKS
FT LGTRLASNTYFELQWYLFSLIFLLMVGYVLKHNGHIRVDVIYARLDDRGRAWVNMLGSI
FT LFVVPFAVLLFYVSLPLVAFSIQVREVSLDAGGLPRWPLKLMLLPAFVLLALQGLSEFI
FT KNLAYLRGALPRPPYEAEGEVA"
ttgaaggcgt tgcttttaat agcccggctg atagatgggc tcaacgaatg ggtggggcgt 60
gtgaccctgt ggctggtggt accgatgatc gctattgggg cctacaacgc cattgggcgc 120
agcctggata agagcctggg aacccgcctg gcctccaaca cttactttga gctgcagtgg 180
tatctttttt ccctgatttt tcttctgatg gtagggtatg tgctcaaaca caacggccat 240
atccgggtgg atgtgatcta tgcccgcctg gacgaccgag gccgggcctg ggtcaatatg 300
ctcggatcta ttttgttcgt ggtgcctttt gccgtgctgc tcttttatgt ctctttgcca 360
ctggtggcct tctcgataca ggtacgggaa gtctccttag acgcgggtgg gctgccccgc 420
tggcccctca agctgatgct gcttccagcc tttgtactgc tggccctgca gggcctatca 480
gagttcatta agaacctggc gtacctgcgt ggggccttgc ccaggccgcc ctatgaggct 540
gaaggggagg tggcctag 558
//
If you have problems or comments...
Back to PBIL home page