(data stored in ACNUC7421 zone)

EMBL: CP001743.PE412

CP001743.PE412       Location/Qualifiers
FT   CDS_pept        394865..395422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0417"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; SPTR: A0YPZ6 Tripartite
FT                   ATP-independent periplasmic transporter, DctQ component;
FT                   InterPro IPR007387; COGs: COG4665 TRAP-type
FT                   mannitol/chloroaromatic compound transport system small
FT                   permease component; KEGG: tbd:Tbd_2150 TRAP transporter,
FT                   small subunit; PFAM: Tripartite ATP-independent periplasmic
FT                   transporters, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27194"
FT                   /protein_id="ADD27194.1"
FT                   /translation="MKALLLIARLIDGLNEWVGRVTLWLVVPMIAIGAYNAIGRSLDKS
FT                   LGTRLASNTYFELQWYLFSLIFLLMVGYVLKHNGHIRVDVIYARLDDRGRAWVNMLGSI
FT                   LFVVPFAVLLFYVSLPLVAFSIQVREVSLDAGGLPRWPLKLMLLPAFVLLALQGLSEFI
FT                   KNLAYLRGALPRPPYEAEGEVA"
     ttgaaggcgt tgcttttaat agcccggctg atagatgggc tcaacgaatg ggtggggcgt        60
     gtgaccctgt ggctggtggt accgatgatc gctattgggg cctacaacgc cattgggcgc       120
     agcctggata agagcctggg aacccgcctg gcctccaaca cttactttga gctgcagtgg       180
     tatctttttt ccctgatttt tcttctgatg gtagggtatg tgctcaaaca caacggccat       240
     atccgggtgg atgtgatcta tgcccgcctg gacgaccgag gccgggcctg ggtcaatatg       300
     ctcggatcta ttttgttcgt ggtgcctttt gccgtgctgc tcttttatgt ctctttgcca       360
     ctggtggcct tctcgataca ggtacgggaa gtctccttag acgcgggtgg gctgccccgc       420
     tggcccctca agctgatgct gcttccagcc tttgtactgc tggccctgca gggcctatca       480
     gagttcatta agaacctggc gtacctgcgt ggggccttgc ccaggccgcc ctatgaggct       540
     gaaggggagg tggcctag                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page