(data stored in ACNUC7421 zone)

EMBL: CP001743.PE417

CP001743.PE417       Location/Qualifiers
FT   CDS_pept        400925..401968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0422"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PRIAM: Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing); PFAM: sugar isomerase (SIS); SPTR: A3LEL0
FT                   Putative uncharacterized protein; KEGG: sml:Smlt4021
FT                   putative phosphosugar-binding protein; COGs: COG2222
FT                   phosphosugar isomerase; InterPro IPR001347; PFAM: SIS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27199"
FT                   /protein_id="ADD27199.1"
FT                   /translation="MRAVETKMFKEAHQAPAVVEQALRENKSEMELLGTFLRRHTPPFA
FT                   LTVARGSSDHAALYGKYLIESLLGLVCSSAIPSVHTVYGQRLALSRALVIAISQSGQSP
FT                   DLIEVTRQARREGALTLALVNQEHSPLAQTAEVVLPLWAGLEEAVAATKSYLAALASLA
FT                   QLVAAWAEDKPLKEALARLPEAMYKAAEANWQAGLEPLVEAENGLVVGRGYAFAVANEL
FT                   ALKLKETSAFHAEAMSGAELLHGPVALVEPDFPLLVLAPKDKPLPGMLSLLENLRSKGG
FT                   HLLVASSESEALELAHTPLPLPGRLHPVLDSILLAQAFYPFAAELSVARGFDPDAPRNL
FT                   SKVTRTR"
     atgagagcgg tcgaaaccaa gatgttcaaa gaagcccatc aagcccctgc ggtggtggag        60
     caggccttgc gagaaaacaa gagcgagatg gagttactcg gcaccttcct gcgccgccac       120
     accccgccct ttgcgctgac ggtggctcga ggtagctccg accatgcagc cctgtacggt       180
     aagtatctaa tcgaaagcct gctgggcctg gtctgctcct cggccatccc ctcggtgcac       240
     acggtttacg ggcagcgcct ggccctgagc cgggcgttgg tgatcgccat ctcgcagtcg       300
     ggccagagcc cggatctgat cgaggtcacc cgccaggccc ggcgcgaagg ggccctgacc       360
     ctggccctgg tcaaccagga gcactccccc ctggcccaga ccgccgaggt ggtgctgccg       420
     ctgtgggcgg gcctcgagga ggcggtggcg gccaccaaga gctacctggc cgccctggcc       480
     tcgctggccc agttggtcgc cgcctgggcc gaagacaaac ccctcaaaga agccctggcg       540
     aggctgccgg aagccatgta caaagccgct gaggccaact ggcaggccgg gctggagccg       600
     ctggtggaag cagaaaacgg cctggtggtg gggcggggct acgcttttgc ggtggccaac       660
     gagctggccc tcaagctcaa ggagaccagc gcctttcacg ccgaggccat gtcgggcgcc       720
     gagcttttgc acggcccggt ggcgctggtg gaacccgact tccccctgct ggtgctggct       780
     cccaaagaca aaccactgcc cggcatgctg agcctgctgg aaaacctgcg tagcaaaggc       840
     ggacacctgc tggtggcctc ctccgaaagc gaggcgctgg agctggccca cacccccttg       900
     ccgctccccg gcaggctcca cccggtgctg gactccattc tgctggccca ggccttttac       960
     cccttcgccg ccgaactctc ggtggcccgg ggcttcgacc ccgatgcccc gcgcaacctg      1020
     tccaaggtga cccgcacgcg ttga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page