(data stored in ACNUC7421 zone)

EMBL: CP001743.PE421

CP001743.PE421       Location/Qualifiers
FT   CDS_pept        complement(404595..405203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0426"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; InterPro
FT                   IPR001808:IPR000595:IPR012318; KEGG: mag:amb2324
FT                   cAMP-binding protein - catabolite gene activator and
FT                   regulatory subunit of cAMP-dependent protein kinase; COGs:
FT                   COG0664 cAMP-binding protein - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinase;
FT                   SPTR: A3ZXR8 Transcriptional regulator; PFAM: Bacterial
FT                   regulatory proteins, crp family; Cyclic nucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27203"
FT                   /protein_id="ADD27203.1"
FT                   /translation="MQTSILDTLTFDPGEIILYPGEPSPKDQLYRVREGLVRLQSVDDE
FT                   GNALTLRFVRPGEYFGEEVISGAERTYFAEAVTETKVDALAPGQLSAQEMHELVQGLVR
FT                   ALSQTYQTIQRISGQRLKNRIAATLLELSRTPVAFMEKNGRIGVRATHDEIASAVGSVR
FT                   ETVTKVIGELTREGYIRSGYGKLVLENPSGLERLSKEAA"
     atgcaaacca gcatccttga taccctaacc ttcgatcctg gcgagatcat tctctatccg        60
     ggcgagccca gccccaagga tcagctctac cgggtacggg aaggtctggt acggctccag       120
     agcgtggacg atgagggcaa cgctctgacg ttacgcttcg tgcgccctgg tgagtatttc       180
     ggcgaagagg tcatctccgg tgccgagcgc acctacttcg ccgaggctgt aaccgaaacc       240
     aaggttgatg ccctggcacc cgggcagctt tctgcgcagg aaatgcacga gctggtgcag       300
     gggctggtgc gggccctgag ccagacctac cagaccattc aacgcatctc cggccagcgt       360
     cttaaaaatc gcatcgcggc caccttgctc gagctatccc gcacgccggt ggcctttatg       420
     gagaaaaacg gccggatcgg ggtgcgggcc acccacgacg aaattgcctc ggcggtgggc       480
     tcggtgcgcg agaccgtgac caaggtcatc ggcgagctga cccgcgaggg ctacatccgc       540
     tccggctacg gcaagctggt actggaaaac cccagcggcc tcgagcggct ctctaaagag       600
     gcggcctag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page