(data stored in ACNUC7421 zone)

EMBL: CP001743.PE425

CP001743.PE425       Location/Qualifiers
FT   CDS_pept        complement(407595..408050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0430"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; SPTR: A6BK61
FT                   Putative uncharacterized protein; InterPro IPR005302; COGs:
FT                   COG2258 conserved hypothetical protein; KEGG: sun:SUN_0055
FT                   hypothetical protein; PFAM: MOSC domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27207"
FT                   /protein_id="ADD27207.1"
FT                   /translation="MPQLLSLHAGLAPSLPKPALLQVRLVEGQGVEGDRHFGRHPDRAV
FT                   LVAGQTSYAKAHQAGIELPWGALGENLLVDFDPHALGPHSRLKIGTAVLELTTVCTVCD
FT                   TLSAFDLRLPKVLYNARGVYARVLQGGLVRVGDPVEVLTPDSLLRMG"
     atgccgcaac tgctctccct ccacgccggg ctcgccccca gcctgcccaa accggcctta        60
     ttgcaggttc gcctggtcga gggccagggc gtggagggtg atcggcactt tggccggcac       120
     cccgaccggg cggtgctggt ggcggggcag accagctacg cgaaagcgca ccaggccggc       180
     atcgagctgc cctggggggc tctgggcgag aacctgctgg tggacttcga cccccatgcg       240
     ctgggcccgc acagtcggtt gaagattgga acggcggtgc tcgagctcac caccgtctgc       300
     acggtctgcg acaccctatc ggccttcgac ctgcgcttac ccaaggtgct ttacaacgcc       360
     cgtggtgttt acgccagagt cctgcagggc gggctggtgc gggtgggcga cccggtggag       420
     gtgctcaccc cagattccct gctccgcatg gggtag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page