(data stored in ACNUC7421 zone)

EMBL: CP001743.PE43

CP001743.PE43        Location/Qualifiers
FT   CDS_pept        complement(37152..38066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0044"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; SPTR: A4BGH5 Putative
FT                   binding-protein-dependent transport protein; InterPro
FT                   IPR000515; COGs: COG1175 ABC-type sugar transport systems
FT                   permease components; KEGG: atc:AGR_L_458 sugar ABC
FT                   transporter, permease protein; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26825"
FT                   /protein_id="ADD26825.1"
FT                   /translation="MRPSEPARRGVSLAHREALWALAFLIVPLAFFLFIRIWPAFQALW
FT                   LSLFDWHADPSQRPFVGLEHYHQMLDDRLLLKALQNTLAYTLLGVPLQLLLGLCIALLL
FT                   NAVTRFRDVFRAIYFAPYVTPAAAIAWVFSWMLSPNFGIVNEILGVFGIPPQPFLTSPS
FT                   QALATVTMVVVWQNLGFQVVLFLAGLQNIPRDYYEAARIDGANNWQLFRHITLPLLNPV
FT                   MVFSAVIGTIGFLQLFTQVVNLNFTDQGGPLGSTLTLALYIYQQAFARFDLGYAAAITV
FT                   LLFVIILVITLVQLRLLSRRVEY"
     atgagaccgt ctgaacccgc ccgacgcggc gtctcgctgg cccaccgtga ggcgctctgg        60
     gccctggcct tcttaatcgt cccgctggcc tttttcctgt ttatccgcat ctggccagcc       120
     ttccaggctt tgtggctctc gctcttcgac tggcacgccg accccagcca acggcctttt       180
     gtgggcctcg agcactacca tcagatgctg gacgaccggc tcctgctcaa agccctgcaa       240
     aacacactgg cctacaccct gctgggcgtt ccgctgcagc tcctgctagg gctttgcatc       300
     gccctcttgc tcaacgcggt gacgcgcttt cgggacgtgt tccgggccat ctactttgcg       360
     ccctacgtca cccctgcggc tgccatcgcc tgggtgttta gctggatgct atcacccaac       420
     tttggcatcg ttaacgagat tctgggggtg tttggtatcc cgccccagcc cttcctgacc       480
     agcccctccc aggccctggc cacagtgacg atggtggtgg tgtggcaaaa cctgggtttt       540
     caggtggtgc tgtttctggc gggtctgcaa aacatccccc gcgactacta cgaggccgct       600
     cggattgacg gggccaataa ctggcagctc ttccgccaca tcacccttcc gcttttgaac       660
     ccggtgatgg tcttctcggc ggtaatcggc accatcggct ttttgcagct gttcacccag       720
     gtggtcaacc tcaacttcac cgaccagggc gggccgctgg gctccacgct caccctggct       780
     ctgtacatct accagcaagc ctttgcccgg tttgacctgg gctatgctgc cgccatcacg       840
     gtgctgctgt tcgtgattat cctggtcatc accctggtgc aactgcggct gctgtcgcga       900
     cgggtggagt actga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page