(data stored in ACNUC7421 zone)

EMBL: CP001743.PE431

CP001743.PE431       Location/Qualifiers
FT   CDS_pept        complement(415028..417448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0436"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.6.2.2"
FT                   /note="InterPro IPR002205:IPR006691:IPR005743; TIGRFAM: DNA
FT                   gyrase, A subunit; PRIAM: DNA topoisomerase
FT                   (ATP-hydrolyzing); COGs: COG0188 Type IIA topoisomerase
FT                   (DNA gyrase/topo II topoisomerase IV) A subunit; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A; SPTR: P94605 DNA gyrase
FT                   subunit A; KEGG: bha:BH0007 DNA gyrase subunit A; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; PFAM: DNA gyrase/topoisomerase IV, subunit
FT                   A; DNA gyrase C-terminal domain, beta-propeller; TIGRFAM:
FT                   DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27213"
FT                   /protein_id="ADD27213.1"
FT                   /translation="MSQVLPVEITDEVKQSFINYAMSVIVDRALPDVRDGLKPVQRRIL
FT                   YGAYQDGVLPSRKHVKCAKIVGEVMGKFHPHGDAAIYDTLVRLAQPWNLRYPLIDGQGN
FT                   FGSVDGDPPAAQRYTEARLSNIGLELLQDLDKETVPFVPNYDGTQEQPEVLPAALPNLL
FT                   VNGSAGIAVGMATSLPPHNLGEVVDALVLMIDNPEVTLEEVMKVLPGPDFPTGAKLSRR
FT                   GIKEAYATGRGSLKVRARVRNEDKNGRAMLVFTEIPYQVNKADLIAQIASLVRNKVIDE
FT                   IAALRDESDRQGMRIAVELKRGANPQVVLNKLYKHSRLQTSFTVNLLAIVKGEPKVLTL
FT                   LELMRHYLDHRGLVVRKRTEYELRKARERAHVLEGLLIALDHIDEVIALIRGSQDAAEA
FT                   RAGLMGRFSLTEVQAQAILDMRLQRLVGLERDKLQAEYRELMEEIGRLEAILGDEKRLW
FT                   RVVRDELLAIKDKYGDQRRTQITEFEEGFSLEDLIEDEPMVITLTSQGFVKRTPLEAYR
FT                   AQGRGGMGAQAGKTKEEDEAISVFVASMHDTLLIFTNRGRVYGEKVHELPEASRQARGT
FT                   HIVSLLPLQEGEEVAALLNVRDLTQEGYFVFATKNGLIKKTEIKEYQNLSSAGLIAINL
FT                   LENDALVGVAIAQEGDQVMLATQSGQAIRFELSDVRATGRASQGVTGIRFKEGRDDRVV
FT                   SLVILPKGEESEVLAVGSHGYGKRTPISEYPLQGRGGMGVITFNTNEKVGQLAALMRVQ
FT                   GNEDLLVLSRRGNAIRTKVSSIAQYGRATSGVRVMNLSDKDEIASAFVIAPQD"
     atgtcccagg tcttacccgt tgaaatcacc gacgaagtca aacaaagctt tatcaactac        60
     gcgatgtcgg tcatcgtcga ccgggccctg cccgatgtgc gcgatggcct caagccggta       120
     cagcggcgca tcctctacgg ggcttaccag gacggcgtgc tgcccagccg caaacacgtc       180
     aaatgcgcca agattgtggg cgaggtgatg ggtaagttcc acccccatgg cgacgccgcc       240
     atctacgaca ccctggtgcg cctggcccag ccctggaacc tgcgttaccc actcattgac       300
     gggcagggca acttcggctc ggtggacggc gaccccccgg cggcccagcg ctacaccgag       360
     gcccggctct ccaacatcgg cctcgagctc ctgcaggatc tcgacaaaga aaccgtgccc       420
     ttcgtaccca actacgacgg cacccaggag cagcccgagg tgctcccggc cgccctgccc       480
     aacctgctgg tcaacggctc ggcggggatt gccgtgggca tggccaccag cctcccaccc       540
     cacaacctgg gcgaggtagt ggacgctttg gtgctgatga ttgacaaccc cgaggttacc       600
     ctcgaggagg tcatgaaggt gctgcccggc cccgactttc ccacgggggc caagctctcg       660
     cgccggggta tcaaggaggc ctacgccacc gggcgcggca gcctcaaggt gcgggcccgg       720
     gtgcgcaacg aagacaaaaa cggccgggcc atgctggtct ttaccgagat tccctaccag       780
     gtcaacaagg ccgatctgat cgcccagatc gcctcactgg tgcgcaacaa ggtgatcgac       840
     gagatcgcgg ccctgcgcga cgagtcggat cgccagggga tgcgcatcgc ggtggagctc       900
     aagcgcgggg ccaaccccca ggtggtgctc aacaagctct acaaacactc ccgcctgcaa       960
     accagcttca ccgtgaacct gctggcgatt gtcaagggcg agcccaaggt gctcaccctg      1020
     ctggagctca tgcgccacta cctcgaccac cggggcctgg tggtgcgcaa gcgcaccgag      1080
     tacgagctgc gcaaggccag ggagcgggcc cacgtgctcg aggggctcct gattgccctc      1140
     gaccacatcg acgaggtgat cgccctgatc cgcggctcgc aggatgccgc cgaagcccgc      1200
     gccgggctga tgggccgctt tagcctgacc gaggtgcagg cccaggccat cctggacatg      1260
     cgtttgcagc ggctggtggg cctcgagcgc gacaaactac aggccgagta ccgcgagcta      1320
     atggaggaga ttggccgcct cgaggccatc ctgggcgacg aaaaacggct ttggcgggtg      1380
     gttagggacg aattgctggc cataaaggac aaatacggcg accagcggcg cacccagatc      1440
     accgagtttg aggaaggctt cagcctcgag gatctgattg aggacgagcc gatggtcatc      1500
     accctgacca gccagggctt cgtcaaacgc accccgctcg aggcctaccg ggcccagggc      1560
     cgcggcggca tgggagccca ggccggcaaa accaaggaag aagacgaggc catctcggtg      1620
     tttgtggcct cgatgcacga caccctgctg atcttcacca accgcggccg ggtctacggc      1680
     gagaaggttc acgagctgcc cgaggccagc cggcaggctc gaggcaccca catcgtgagc      1740
     ctgctgccct tgcaagaggg cgaggaggtt gcggccctgc tcaacgtgcg cgacctgacc      1800
     caggaaggct actttgtgtt tgccaccaaa aacggcctta tcaagaaaac cgagattaag      1860
     gagtaccaga acctcagcag cgccggcctg attgccatca atctgctaga aaacgatgcc      1920
     ctggtggggg tggccattgc ccaggaaggc gaccaggtca tgctcgcaac ccagagcggc      1980
     caggccatcc gcttcgaact ctcggacgtg cgggccactg gacgggccag ccagggcgtg      2040
     accggcatcc gcttcaaaga aggccgcgac gaccgggtgg tctcgctggt gattctgccc      2100
     aaaggcgagg agagcgaggt gctggcagtg ggcagccatg gctatggcaa gcgcaccccc      2160
     atctccgagt accccctgca gggccggggc ggcatggggg tgatcacctt caacaccaac      2220
     gaaaaggtgg gccagttagc ggccctgatg cgcgtacagg ggaacgaaga cctgctggtg      2280
     ctctcgcggc ggggcaacgc catccgcacc aaggtctcca gcatcgccca gtacgggcgg      2340
     gccaccagtg gggtcagggt gatgaacctg agcgataagg acgagatcgc ctcggctttt      2400
     gtgattgcgc cgcaggatta g                                                2421
//

If you have problems or comments...

PBIL Back to PBIL home page