(data stored in ACNUC7421 zone)

EMBL: CP001743.PE435

CP001743.PE435       Location/Qualifiers
FT   CDS_pept        complement(420964..421542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0440"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27217"
FT                   /protein_id="ADD27217.1"
FT                   /translation="MTASVKHRLYSGLVYDDFSTLLDRILETIDEHHATNRELAVVKSA
FT                   LETAINRYASRPNLLEEIDHAYKALERKLNHFAQVGKPIKATAIREEIHELNDLLYFSE
FT                   QASNQIERLASKIIMLEKTRAIIRFKLAKMLELQQLILYISAARDTFAKIASQEQLDLL
FT                   EESLRREILNPLRLELLPLGVTTTRARVH"
     atgacagctt ctgtgaagca caggctctac tccggtttgg tttacgatga cttctccact        60
     ttgctcgatc gcatccttga aacaatagac gagcaccacg ccaccaaccg cgaactggcg       120
     gtggtcaaaa gcgctctgga gactgccata aaccgctatg catcccgacc caacttactc       180
     gaggaaatag atcacgcata taaagctctg gaacgcaagt taaaccattt cgcacaggtc       240
     ggaaaaccaa taaaagctac cgcgatacgt gaggaaatcc acgaactcaa cgatttgctc       300
     tacttctcag aacaagcgtc taatcagatt gaacgtctcg cgagcaaaat tatcatgctc       360
     gagaagaccc gggccattat ccgctttaag ttggccaaaa tgctagaact tcaacagctt       420
     attctgtaca tcagcgcagc acgagatact ttcgcaaaga tagccagcca agaacaactg       480
     gacttattag aggaaagcct aaggagagag attctgaacc cacttcgttt agagttattg       540
     cctcttggag tcaccactac cagagcacgg gttcactaa                              579
//

If you have problems or comments...

PBIL Back to PBIL home page