(data stored in ACNUC7421 zone)

EMBL: CP001743.PE436

CP001743.PE436       Location/Qualifiers
FT   CDS_pept        421869..426149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0441"
FT                   /product="protein of unknown function DUF450"
FT                   /note="PFAM: protein of unknown function DUF450; InterPro
FT                   IPR002296:IPR007409:IPR002052; KEGG: vei:Veis_1308 putative
FT                   type II DNA modification enzyme; SPTR: O52000 Putative
FT                   uncharacterized protein; PFAM: Type I restriction enzyme R
FT                   protein N terminus (HSDR_N)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27218"
FT                   /protein_id="ADD27218.1"
FT                   /translation="MLNLSEGQTESVPISLRNQEAERLRDFDGLFQIYLVRYKAYPPTK
FT                   QVEAYLAKTGSSALVLFTSDEKSFVLSYVDGDRAINARAQKDWVENLLKDLLELYQETG
FT                   DVLKLSESAQDAIHAQADENINRQKRPYRNQGLFSDHYLDTRLRESSEWLEDSEPLRKR
FT                   LLELYKDKESLLKVANEAQTEDEFIRPVLESLGFAYWVQDTTKATGGPQRPDYVLYPDE
FT                   GTKSRAVVHKANEAKRYAPALAIAEAKYWGRDLDVKRKDGRDRVQSPVSPSFQLSDYLS
FT                   STSLEWGILTNGQEWRLYWGKAADKQKRYFAVDLVQALQDPEAFRFFWLFFRREAFTKG
FT                   AQGSFLGRILEGSEQYGLRVGKRLKGVVFEQVFPLLAEGFLRYHKQVLKQPPDKAMLQE
FT                   TYRATLSLLYRLLFLLYAEDRDLLPVSDTLGYQQYSLSRIRRNVAEWLDQGRAYSEQSY
FT                   SLWERLSTLFTFIDKGDSTLRVPPYNGGLFKPGVYPFLDTHKVADAFLAPALDKLARQE
FT                   DEDGKLRFVDYKYLTVRELGAVYEGLLEFSLKVAEEDLVVVKDDDREVYKPKAKLTAKE
FT                   KPVAEVPKGKPYLVNDKTERHASGSYYTPDYVVEYIVRRALEPVVAKRREALEKVLTEY
FT                   AHWSKKQDKRPTKQNVERLTELRHKALDTLLDVKVVDPAMGSGHFLVGAVDFLSERFAN
FT                   LITELRAEPITDALAGLRDEIKAQMKQYGLELKDEQLSDINLLKRMVMKRCVFGVDLNS
FT                   MAVELAKLSLWLDAFTVGAPLSFLDHHLRHGNSVLGVSRSEFVRWVERENPVWLSELER
FT                   EVEEATRKAQELLSVRDLTPAEVELSQSLYAHWEFEFPEVFFGPERKYNPGFDAVIGNP
FT                   PYVRQEQLGPNKPFFEKAYESIYAGAADLYTYFFARGLGVLREGGRLGFISSRQFTRAA
FT                   YGEGLRKLLTAHTLLEITDFGENPVFEGVGTFPAIFILEKGQPAYPIRYKAVSKAEFSA
FT                   LMEKPSEARAEELAQLVEGGQNLGPEAFRPEGWTLGSADENAILRKMEENGVPLGAYVE
FT                   GIYYGIKTGFNEAFFIDEPTRNRLIKEDSRSAELIKPLLVGDDVRHYYARWPKTYLILI
FT                   PSSSHFDEGSWADSQIQEEAEQIFKETYPAIYKHLVSWRDKLKARSDQGRWWWELRPCA
FT                   YYQLLEAPKIVYPEIAKEPRFYLDYRGFYINKKLFFIPRADWYLLAVLNSRVAFGILKL
FT                   RLSALGDADEGGRLELRAVHLQHLPIPKVPHTTQASELEIALEEARKHYAQGEVSAALT
FT                   WAEKELVAGCRDTVAAFLGFLAQEMQRMQAERLSLEGGWRGWVEHAFQGTGKLGKEWLA
FT                   EDWAREGLGVGVEAITERFKVKRVKTTPQTLAQLKMHTQETLDQLRPLYQRLEATDRLI
FT                   DRLVARLYGLTDEEAERLWATPSS"
     atgttgaatt tgtcagaagg tcagactgaa tctgttccca ttagtttgag gaatcaagag        60
     gccgagcgtc tacgagattt tgatgggttg ttccaaattt acttggtgcg ctacaaagcc       120
     tacccaccca caaagcaagt ggaggcctat ctggccaaaa cagggagttc ggctctggtg       180
     ctttttacaa gtgatgaaaa gagctttgtt ctctcttatg tagatggtga tcgggctatc       240
     aatgctcgag cccaaaaaga ttgggtagag aacctactta aagaccttct ggagctttat       300
     caggaaacgg gcgatgtact gaagctgtcg gagtcagctc aagatgccat tcatgctcag       360
     gccgatgaaa atataaatcg tcagaagcgc ccctatcgta accaggggct ttttagcgat       420
     cactacctag atacccgtct ccgggagagt tcggagtggc tggaggattc agagccgcta       480
     aggaagaggc tgctcgagct ctacaaggac aaggaaagcc tcctcaaagt agctaatgaa       540
     gcccaaactg aagatgagtt tatccggccc gtcctcgagt cccttggctt cgcttactgg       600
     gtgcaagata ccaccaaagc cactggtggg cctcaacgcc cagactacgt gctctacccc       660
     gatgagggca caaagagtag agctgttgtg cacaaagcaa acgaggccaa gcggtacgcc       720
     ccagccctgg ccatagccga ggccaagtac tgggggcgtg accttgatgt gaagcgaaag       780
     gatggcaggg atcgtgtaca aagcccggtc agcccatcct tccagcttag tgactacctt       840
     tcctctacga gcctggaatg gggcattctg accaatggcc aggaatggcg actgtactgg       900
     ggtaaagcag ccgataagca gaagcgctac ttcgcagtgg atctggtaca ggccctccag       960
     gatcccgagg ctttccgctt cttctggctg ttcttccgtc gcgaggcctt tacaaagggc      1020
     gcgcagggta gcttccttgg gcgcattctc gagggcagcg agcagtacgg cttgcgggtg      1080
     gggaaaaggc tcaagggcgt ggtcttcgaa caggttttcc ctcttctggc cgaagggttt      1140
     ctgcgctacc acaagcaggt gcttaagcag ccgccagaca aggctatgtt gcaggagacc      1200
     taccgggcca ccctgagctt gctctaccgg ctcttatttc tgctgtatgc cgaagaccgc      1260
     gacttgcttc cggtttcgga tacgttgggt tatcagcagt acagcctttc acgcatccgc      1320
     cgcaacgttg ccgaatggct agatcagggt cgagcttaca gcgagcaatc ctacagtctt      1380
     tgggagcgcc tcagcaccct tttcaccttc attgataagg gggattctac gcttagggtt      1440
     cctccctaca acggagggct ctttaagcca ggggtgtatc cttttctaga cacccacaag      1500
     gtagccgatg cctttctggc ccccgcgctg gacaaactgg cgcgtcagga ggacgaggac      1560
     ggcaagctcc gttttgtgga ctacaaatac cttacggtgc gggagctagg ggccgtatac      1620
     gaagggttgc tggaattcag cttgaaggtg gcggaagaag acctggtggt ggtaaaagac      1680
     gatgatcgcg aggtctataa gccaaaggcg aagctcactg ctaaggagaa gcccgtcgcc      1740
     gaagtcccca agggcaagcc ctatctggtc aacgacaaaa cggagcgcca cgcctccggc      1800
     agctactaca ctcccgacta tgtggtggag tacatcgtac gcagggcttt ggagccggtg      1860
     gtcgcgaagc gtagagaggc gctagagaag gttctgactg agtacgccca ctggagcaag      1920
     aagcaggata agcgccccac aaagcagaac gttgagcggc tgaccgagct tcgccacaaa      1980
     gcgctggata ccctcctgga tgtcaaggtg gtagacccgg ccatgggctc gggccacttt      2040
     ctggtggggg cggtggactt cctttccgag cgctttgcca acctgatcac cgaactcagg      2100
     gccgaaccca ttaccgatgc cctagccggg ttgcgggatg agattaaggc gcagatgaag      2160
     cagtacggcc tcgagctgaa agacgaacaa ctctccgata tcaacctgct caagcgcatg      2220
     gtgatgaagc gctgcgtctt tggggtggat ctcaactcca tggctgtgga actggccaag      2280
     ctctcgctgt ggctggacgc cttcacggta ggggcgcctc tttctttcct ggatcatcac      2340
     ctgcgccacg gtaacagcgt gctgggggtg tccaggagcg agtttgtgcg ttgggtggag      2400
     cgggagaacc cggtttggct atccgagctc gagcgtgagg tggaggaggc cacccgcaag      2460
     gcccaggagc tcctaagcgt gcgcgacctc accccagccg aagtggaact ctcccaaagc      2520
     ctctacgccc actgggagtt cgagtttccc gaggttttct ttggcccgga acgcaaatac      2580
     aaccccggct tcgatgcggt gatcggcaac ccgccctatg tgcgccagga gcagcttgga      2640
     cccaacaagc cgtttttcga gaaagcctac gagagtattt acgcaggagc tgccgacctg      2700
     tacacctact tctttgctag gggcctgggg gtgctccgcg agggcggacg gctggggttc      2760
     atctcttctc gccagttcac ccgcgcggcc tacggcgagg gcttgcggaa gctgctcacg      2820
     gcccacactc tcctagagat taccgacttc ggcgagaacc cggtcttcga gggggtgggc      2880
     accttcccgg ccatcttcat cctggagaag ggccaaccag cctaccccat ccgctacaag      2940
     gcggtgagca aggccgagtt ttcggcgctg atggaaaagc cctcagaagc tcgagcggaa      3000
     gagctggccc aattggtgga aggcggccag aacctaggcc cggaggcttt ccgccccgag      3060
     ggatggaccc tggggagcgc cgacgagaac gccatcctgc gcaagatgga agagaacggg      3120
     gtgccgcttg gggcgtatgt agagggcatt tattacggta tcaagactgg cttcaacgag      3180
     gctttcttca ttgacgagcc tacccgcaac cgcctgatca aggaggactc caggagtgcc      3240
     gaactcatca agcctctgtt ggtgggggat gatgtgcggc attactatgc tcggtggccc      3300
     aaaacttact tgattttgat accaagtagc agccatttcg acgaaggttc atgggcggat      3360
     tcacaaattc aggaagaggc agaacaaatc tttaaggaaa cctaccctgc catctataaa      3420
     catctggttt cctggagaga taagctgaag gcaagaagtg atcaggggcg ctggtggtgg      3480
     gagcttagac cttgcgctta ttatcaactc ctcgaggccc ccaagattgt gtaccccgaa      3540
     atagctaagg aaccgcgttt ctatttggat tacagaggct tctatatcaa taagaaactc      3600
     tttttcattc cccgagcaga ctggtatctc ctggcagtgc tgaactccag ggtggctttt      3660
     ggcatcctta agctcaggct atctgcactt ggcgatgcag acgaaggagg ccgcttagaa      3720
     cttcgagctg tccacctcca gcaccttccc atccctaaag ttccccacac cacccaggcc      3780
     tcagaactgg aaatagcctt agaggaagct cggaaacact acgctcaagg ggaagtttcg      3840
     gcagccttga cctgggctga aaaggagctg gttgcggggt gcagggatac tgtggccgcc      3900
     ttcctgggct tcctggccca ggagatgcag cgcatgcagg ccgagcggct gtcgcttgag      3960
     gggggctggc gagggtgggt ggagcacgct tttcagggca caggaaagct gggtaaggaa      4020
     tggttggcgg aggactgggc aagggagggg ctaggggtgg gtgtcgaagc catcaccgag      4080
     cgcttcaagg tgaaaagggt caagaccacc ccccagaccc tggcccagct caagatgcac      4140
     acccaggaaa ccctcgacca actccgccct ctttaccagc gcctggaagc taccgatcgg      4200
     ctcattgacc ggctcgtggc tcggctttac gggcttaccg acgaggaagc agaaaggcta      4260
     tgggctaccc catcgtcata g                                                4281
//

If you have problems or comments...

PBIL Back to PBIL home page