(data stored in ACNUC7421 zone)

EMBL: CP001743.PE437

CP001743.PE437       Location/Qualifiers
FT   CDS_pept        426128..426679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27219"
FT                   /protein_id="ADD27219.1"
FT                   /translation="MGYPIVIGRFRGEVLLDLEGLFLLVSLNSSCSEEEILSDLNSLHL
FT                   VGVLLLQQKALFVGSSRVLSTDWNQPWLEGLLRMVEGADPLQAERIAERVFLRRIFAKG
FT                   LQGLLELERHMQRLKKHAKQAEEDCLHAGAYAEGNEWKAWLQEIEDIEPRLRNLELTLG
FT                   RFAVRLGNRWLWGSEDDQST"
     atgggctacc ccatcgtcat agggcgcttt cgcggagagg ttttgcttga cctggaggga        60
     cttttcctgc tggtaagcct gaattcatct tgctcagaag aggaaatact ctccgatttg       120
     aacagccttc acctggtggg ggtgctgctt ttacagcaga aagctttatt tgttggaagt       180
     tcgcgggttt tgtcaaccga ttggaaccag ccctggctag agggactgtt gcgaatggtt       240
     gagggggctg atccgcttca ggctgagcga attgcggagc gggtgttctt aaggcgaatt       300
     ttcgcgaaag ggctacaggg tttattggag ctagaacgcc acatgcagcg gctgaaaaag       360
     catgccaagc aagcagaaga agactgtctt catgccggtg cttacgctga aggtaatgaa       420
     tggaaggctt ggttgcaaga gatagaggac attgagcctc gtttgcggaa ccttgaactt       480
     accttgggcc gctttgccgt gcggttgggt aaccgttggt tatgggggag tgaggatgac       540
     cagagtacct ag                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page