(data stored in ACNUC7421 zone)

EMBL: CP001743.PE438

CP001743.PE438       Location/Qualifiers
FT   CDS_pept        426746..427621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0443"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8203 putative 5-methylcytosine-specific
FT                   restriction enzyme B"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27220"
FT                   /protein_id="ADD27220.1"
FT                   /translation="MSQPYSIGPYKGEVLLSLTGLFHVIRLIPPYPPRAVLEQILKERA
FT                   MPTLVQWDNQVGLVGPEQTLWVEAEQSWMEGLIRQLEPLDPLSAPEIAEQALLEKLVEN
FT                   AGSRLWAFLDDVNMLLTHGEMALETAQASRRYDRVATLAQWLERLLKVQQSGEALAELW
FT                   GAFSGKKRSMPAKHPSKKAPVPDKTRKRTKGAALPQKEYRLPILRALAELGGRGKTAEV
FT                   LDRVYLQLKHLFTDGDLERAYDDPRRDEPIWRNRARWEIAALKEEKLVQSGGYGVLILT
FT                   DKGAAYLHGA"
     atgagccaac catactccat agggccctat aaaggggagg tgctgcttag cttaaccggc        60
     ttattccatg tgattcgact gattccgcct tatccacccc gtgcagttct cgagcaaatc       120
     ctgaaggagc gggcaatgcc cactttggtg cagtgggata accaggtggg cctggtaggg       180
     ccggagcaaa ctctgtgggt agaagccgag caatcgtgga tggaaggctt gatccggcaa       240
     ctggagccgc tagaccccct cagcgcgccc gagatcgccg agcaggccct gctagagaag       300
     ctggtggaga atgctggaag ccgtctgtgg gctttcctgg atgatgtgaa catgctgttg       360
     actcatggcg aaatggcgct agagacggcc caggcatccc gccgttatga ccgggtagct       420
     accctagccc agtggctcga gcgcctgctc aaggtgcagc agagcgggga agccctagcc       480
     gagctttggg gggctttctc tgggaaaaag cgaagcatgc ccgcaaagca tccttcaaaa       540
     aaagcgccag tgcctgataa gacccgcaag cgaaccaaag gtgcggcctt gccacaaaag       600
     gagtaccgtt tgcccatttt gcgtgcgctg gcagaactgg ggggacgtgg aaaaactgcg       660
     gaggtgctgg acagggttta tctgcaactg aaacatcttt ttaccgacgg ggacttggaa       720
     agggcctacg atgatcccag acgggacgaa ccgatatggc gaaaccgagc acgctgggaa       780
     atagctgctt tgaaggaaga gaagctggtg cagagcggtg gctatggggt actgattctc       840
     acagataaag gagcagccta cctgcacggg gcttag                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page