(data stored in ACNUC7421 zone)

EMBL: CP001743.PE439

CP001743.PE439       Location/Qualifiers
FT   CDS_pept        427690..428787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0444"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   SPTR: A6DG29 Filamentation induced by cAMP protein Fic;
FT                   InterPro IPR003812; COGs: COG3177 conserved hypothetical
FT                   protein; KEGG: bur:Bcep18194_B2094 filamentation induced by
FT                   cAMP protein Fic; PFAM: Fic/DOC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27221"
FT                   /protein_id="ADD27221.1"
FT                   /translation="MADSGFGPSDIVAERKALLERLGGLPATLLSVRNEEWLYMLQEDT
FT                   HHSLAIEGHFATEQQLKAVLQGRRSGPEIVNYFRTAQSLYDLALQYHLEGQTHLDLALI
FT                   RHIHSELWRDLAPDRGRFALNGEARVIQGAQVRPPVYDVEAYMRAFVRVTLELLRQYPI
FT                   LEALARSHTLFEAIHPFKDGNGRAGRILLSYLAINQGYVPIVIKGLHPEERNAYYQALE
FT                   AADRGFHQGFPPPKPPLLLERLEEGNFAPLVGLLLEGMLPRLDQTIALSLAARVPLLGL
FT                   EEVARALGVPRGTLYQWRKRGRLIVLKPQGRRAGLLSHPWLFLGTQDTPAQTPANFPPI
FT                   RENQAGQTMSLFEAVLQNPTDTRLE"
     atggccgatt cgggttttgg cccatctgac atagtggccg aacgaaaagc cctgctggag        60
     cggctgggag ggcttccagc caccctgctc tcggtacgca acgaggagtg gttgtacatg       120
     ctgcaggagg acacccacca ctccctggcc atcgaggggc attttgcgac cgagcagcag       180
     ctcaaggcgg tgctgcaagg gcgcaggagc ggccccgaga tcgtcaacta ctttcgcacc       240
     gcgcaaagcc tctacgacct ggccctgcaa taccacctcg agggccagac ccacctcgac       300
     ctggcgctga tccgccacat ccacagcgaa ctctggcgcg acctcgcacc cgaccggggg       360
     cgctttgcct tgaacggcga ggcccgggtc atccagggag cccaggtgcg cccgccggtt       420
     tacgacgtgg aggcctacat gcgggcgttc gtgcgggtga cgctggagct gctgcgtcag       480
     taccccattc tggaggctct ggcccgctcc catacccttt tcgaggccat ccacccgttc       540
     aaagatggca acggacgggc cgggcggatt ctgctgagct acctggcaat caatcagggt       600
     tacgtgccca tcgtgatcaa aggactgcac cccgaagagc gcaatgccta ttaccaggcc       660
     ctcgaggccg ccgaccgggg gtttcaccag ggcttccccc cacccaaacc acccctgctg       720
     ctggagcggc tggaagaagg gaactttgcg ccgctggtgg ggttgctgct cgaggggatg       780
     ctgccccgcc tggatcagac cattgccctg tccctggccg cccgggtgcc cctgctgggc       840
     ctggaggagg tggcccgggc gctgggggta ccccgtggga cgctgtacca gtggcgtaag       900
     cgagggcgtc tgatcgtact caagccacag gggcggcgtg cagggctgct cagccacccc       960
     tggctcttcc tgggaaccca ggacaccccg gcccaaacac ccgcgaactt cccacccatc      1020
     cgcgaaaacc aagcaggcca gaccatgagc ctgtttgaag ccgtgttgca aaaccctacc      1080
     gatactcgtt tggagtga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page