(data stored in ACNUC7421 zone)

EMBL: CP001743.PE44

CP001743.PE44        Location/Qualifiers
FT   CDS_pept        complement(38205..39449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0045"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="COGs: COG1653 ABC-type sugar transport system
FT                   periplasmic component; InterPro IPR006059; KEGG:
FT                   oan:Oant_2485 extracellular solute-binding protein family
FT                   1; SPTR: B5IRL8 Bacterial extracellular solute-binding
FT                   protein, putative; PFAM: extracellular solute-binding
FT                   protein family 1; PFAM: Bacterial extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26826"
FT                   /protein_id="ADD26826.1"
FT                   /translation="MRKALFILTVLLGAALAQGQVTITYWQYDFKSKVEAVNELIKKFE
FT                   AANPGIKVLHQTFPFDAYQQKVASSIPAGQGPDVVNLFYGWLPTWVKAGYLQPLPAEYT
FT                   RVLDNEFSSLAQAAKVGGRLYGMPTAVRSLALFYNRDLLNAAGFKNPPKTWDEFLSIAA
FT                   KLTVKDGNRFSQLGYAMAPDGQDHHLVREVLVRQFGGRPYSDDGRRVLYGDAAGLRAFT
FT                   FYTDWFKKYNVGTLGNQFFPGNNAYRDAFIAGRVGMIVDGSFAIGTIRSGAKFNWGVAE
FT                   LPVEKVGGRKVNYGSFWMHGLTPLATGPKLAASLKFLEFLVSEETQRYWLEKVGELPAR
FT                   KSLIKDPKLTLDRIFGPFVLSLSYAKATPFVDEIGQRKVMTDAINRVLLENRDPAESWR
FT                   IAAAEEQKLLDAFWK"
     atgcgaaaag ccttgttcat cctgaccgtt ttgctgggag cggcactggc ccagggtcag        60
     gtcaccatca cctactggca gtacgacttc aaaagcaagg tcgaggcggt gaatgagctg       120
     atcaaaaaat tcgaggccgc caaccccggc atcaaggtgc tgcatcagac cttccccttc       180
     gacgcctatc agcaaaaggt ggcttcctcg attcccgcgg gccagggacc ggatgtggtc       240
     aacctgtttt atggctggct gcccacctgg gtcaaggccg ggtatctgca acccctgccc       300
     gccgagtaca ccagggtgct ggacaacgag ttctcgagcc tggcccaggc cgccaaggta       360
     gggggcaggc tctacggcat gcccaccgcg gtgcgttcgc tggccctgtt ctacaaccgc       420
     gacctcttga acgccgccgg cttcaagaac ccccccaaaa cctgggacga gttcctgagc       480
     atcgcagcca aactcaccgt taaggacggc aaccggttca gccagctggg ctacgccatg       540
     gcccccgacg ggcaggatca ccacctggta cgcgaggtac tggttcggca gtttggcggg       600
     cggccctact ccgacgacgg gcgccgggtg ctctacggcg atgccgccgg cctcagggcc       660
     ttcaccttct acaccgactg gttcaaaaag tacaacgtgg gcaccctggg caaccagttc       720
     ttccccggca acaacgccta ccgcgacgcc tttatcgccg gccgggtggg catgattgtt       780
     gacggctcat tcgccatcgg caccatccgc agcggggcca agttcaactg gggggtggcc       840
     gagctgcccg tagaaaaagt tggcggtcgc aaggtaaact acggctcctt ctggatgcac       900
     ggcctgaccc ccctggccac cgggcccaag ctggcggcct cgctcaagtt tctggagttt       960
     ttagtctccg aggaaaccca gcgctactgg ctcgagaagg tgggtgagct gccggcccgc      1020
     aagagcctga tcaaagaccc caagctcacg ctggacagga tctttggccc cttcgtgctc      1080
     tcgctgtcct atgccaaggc cacgcctttt gtggatgaaa ttgggcagcg caaggtcatg      1140
     accgatgcca tcaaccgggt gctcctggag aacagagacc ccgcagagtc ctggcgcata      1200
     gccgccgccg aggagcagaa gctgctggat gccttctgga agtag                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page