(data stored in ACNUC7421 zone)

EMBL: CP001743.PE440

CP001743.PE440       Location/Qualifiers
FT   CDS_pept        428790..431840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0445"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SMART: helicase
FT                   domain protein; DEAD-like helicase; InterPro
FT                   IPR001650:IPR014001; KEGG: sfu:Sfum_0411 helicase domain
FT                   protein; SPTR: A5YS53 Helicase, C-terminal; PFAM: Helicase
FT                   conserved C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27222"
FT                   /protein_id="ADD27222.1"
FT                   /translation="MSANLQLPDFIDNDHLKLSEALNFLLRSQPQADIASGYFNLGGYA
FT                   LVKDALAEIPRLRILLSKEGGIAAGELYPAGFQKDLASAKFATRNRELAKELVQLLLRP
FT                   EIEVRLYTKGFFHGKAYIFGDVAIIGSSNFTHAGLTANTELNSVHKQGYAAQAAREWFE
FT                   RFWEQSQDYKLELVRLLEESKLISSGYSPYLIFLKSLYEYFKDELTVDLEKGRNIGKSL
FT                   VDLADFQQKAFERALKILEKYDGVFIADSVGLGKTWIGKKLLEHFGYFQRKKCLVIAPA
FT                   QLSQMWEDELRSIQVAAHVVSMESMGRSNFDASSYFDAEVVLVDESHNFRNSNQRYAAL
FT                   SRIMNAGRRKKAIMLTATPINNSVFDLYNQIMLFARGERYFARAGIPYLRGYFIRALED
FT                   GDLLNLLEEVMVRRTRQFVKQEFPEAVINGEPVRFPRRELHTERYDLEAIYPDLYKQVA
FT                   VRFEELILAAYNPEAFLERPTDKEELERQRNEALIGLIKSLLLKRFESSVEAFRISLRR
FT                   QIAFHERFIEELMHGHLLSSADYRRLIALENEEEVSSSVQSLPTVDASAYRVLELAQVA
FT                   AADLEHLREMLRMVEPVAVENDPKIAKLIELIRERPGKKIVVFSYFQDTIRYLEQAFRE
FT                   TYAESLQAVRWAVVDGSVRTKDRTDILRRFAPKSQKTQVAPEDELDLLLATDVFSEGQN
FT                   LQDADTLINFDLHWNPTRMIQRAGRIDRLGSPFEVIHIHNFFPEDGLEEMLGLLERLME
FT                   KIVQIDKNVGLDASILGEVINPKTFNALRRIEQEDARIADELEAEAEISSEFMRALLST
FT                   YLQKSGAERLEAIPYGVHSGMAGRGRRGIFFHFKVGDEHIWRFYDVDKREILDSKYRIY
FT                   NLIQCEEQTPRVDADYNVDDILAEVSRHLLEDLNIQNAVQVDTLPKAQREVLTALRGLA
FT                   RHPQIDRQELIELLKNLNQPLSRVLVRELESIHKAYEAQPMELVKALRAFVEHYYLTQT
FT                   DQSAQANRRFSEEDLELVVYLTLSATQ"
     atgtctgcca acctgcaatt acccgacttc atcgataatg accaccttaa gctttccgag        60
     gctctgaatt ttctgttgcg aagccaaccc caagccgaca ttgccagtgg ttacttcaat       120
     cttggaggct atgccttggt caaagatgcg ctggctgaga ttccccggct gcggatttta       180
     ctctccaaag aaggaggaat tgcagccggg gaattgtatc cagcgggctt ccaaaaggat       240
     ttggccagtg cgaagtttgc tacacgcaac cgtgaactgg ctaaagaact ggtacaactt       300
     ttattgcggc cagagataga ggtgcgactc tacaccaagg gcttttttca tggcaaggcc       360
     tatatcttcg gagatgttgc tatcatcggc tcttccaact ttacccatgc cgggcttacc       420
     gcaaacaccg aactcaactc ggtgcacaaa cagggttatg cggcccaagc cgcacgggag       480
     tggtttgagc gtttttggga gcagtctcag gattataagc tcgagctggt taggctcttg       540
     gaagagtcca agctcatcag tagcggatac agcccctatc tgattttcct aaagagcctg       600
     tacgaatact tcaaggacga acttaccgtt gacctagaga aaggccgcaa cattggtaag       660
     tccctggtag acctagccga ttttcagcag aaggccttcg agcgggccct aaagattttg       720
     gagaagtacg atggggtctt tatcgccgat tcggtgggtt tgggtaagac ttggatcggt       780
     aagaaactcc tggaacactt cggctacttt cagcgtaaga agtgcttggt aatcgcacca       840
     gctcaacttt cccagatgtg ggaagatgaa ctccgctcca tccaggtagc tgcacacgtt       900
     gtaagtatgg agagcatggg acgctcgaac tttgatgcgt cctcatactt tgatgctgag       960
     gtagtgctgg ttgacgaatc tcacaacttt cgtaattcca accagcgata tgctgctctc      1020
     tctcgcataa tgaatgctgg gcggcgaaag aaagcaataa tgctcacggc aacccccatt      1080
     aacaactctg tcttcgacct ttacaaccag atcatgctct ttgcccgtgg agagcgttac      1140
     tttgcccgtg ctggcattcc ttatttgcgt ggctatttca tccgtgcttt ggaggatggt      1200
     gatctgctga atttgcttga agaggtgatg gttcggcgta ctcgccagtt tgtaaagcag      1260
     gagtttcccg aggccgtcat caatggtgaa ccggtgcgct tccctaggcg tgaattgcat      1320
     accgagcggt acgacctaga agctatttat cccgatctct acaagcaagt agctgtacgc      1380
     ttcgaagagc ttatcttggc ggcctataat ccagaagctt ttctcgagag acccactgat      1440
     aaggaggagc ttgaacgtca gcgcaacgag gctctaattg gtctgatcaa aagtttgcta      1500
     ctcaagcgct ttgagtcaag tgtggaagca tttcgtattt cattgcgtcg tcagattgcc      1560
     tttcatgagc gctttattga ggaacttatg catgggcacc tcctctcgag cgccgattac      1620
     cgtcgcctta tagccctgga gaacgaggag gaggtctctt cttcagtaca atcccttccc      1680
     actgtagatg cttcggcgta ccgagtattg gagctggctc aggtagcagc ggcagacctt      1740
     gagcacctac gcgagatgct gagaatggtg gaacctgtgg ccgtggaaaa cgaccctaag      1800
     atagccaagc tgatcgagtt gattcgcgag agaccaggta aaaaaatagt tgtgttttcc      1860
     tactttcagg ataccatccg ctatcttgag caggccttcc gagaaaccta tgcagaatcc      1920
     ttgcaggctg tgcgatgggc ggtggtggat ggtagcgttc gcaccaaaga ccgtacagac      1980
     attcttaggc gatttgcgcc gaaatctcag aagacccagg ttgctcccga ggatgagctg      2040
     gacctgctcc ttgccactga cgtattttct gaaggccaga acctgcaaga tgctgataca      2100
     ctgatcaact tcgacctgca ctggaaccct acacgtatga ttcaaagagc cgggcgtatt      2160
     gaccgactcg gctctccgtt cgaggtaatc catatccata acttttttcc cgaagatggc      2220
     ctcgaggaga tgctgggctt gcttgagcgg ctaatggaga agattgtaca gatcgataaa      2280
     aacgtgggtc tggatgctag tatcctgggt gaggtgatca atcccaagac ctttaatgcc      2340
     ttgcgccgca tcgagcaaga ggatgcccga attgccgatg aattagaggc tgaggccgag      2400
     atttctagtg aattcatgcg ggccttgctt tctacgtatc tgcaaaaatc tggagcagaa      2460
     cggcttgagg ctattcccta tggggtccac agtggtatgg cagggagagg acggcgaggg      2520
     attttttttc acttcaaagt aggagatgag catatttggc ggttctatga cgtggataag      2580
     agggaaattc ttgactccaa gtatcgtata tataacctca tccagtgcga agaacaaacc      2640
     ccaagagtag atgccgatta taatgttgac gacattctcg ctgaggtaag tcgacacctg      2700
     cttgaggatt taaacatcca aaatgccgtt caagtggata cgcttcccaa agcccagcgt      2760
     gaggttctga ccgctcttag gggattagcc cggcacccac agatagatcg tcaagaattg      2820
     atcgaactgt taaagaatct caatcagcca ctttcacgag tgctggtgcg tgagctcgag      2880
     tctattcata aggcgtatga agcccaacca atggaactcg tgaaagccct tagagctttt      2940
     gtagagcatt attaccttac ccaaacggat caatctgcgc aagcaaatcg tcgttttagt      3000
     gaggaagatc tagaactggt cgtttatttg acgctaagtg caacgcagta a               3051
//

If you have problems or comments...

PBIL Back to PBIL home page