(data stored in ACNUC7421 zone)

EMBL: CP001743.PE441

CP001743.PE441       Location/Qualifiers
FT   CDS_pept        431926..432990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0446"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; InterPro
FT                   IPR002559; KEGG: lpp:lpp2895 hypothetical protein; SPTR:
FT                   A4VBY8 Putative uncharacterized protein; PFAM: Transposase
FT                   DDE domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27223"
FT                   /protein_id="ADD27223.1"
FT                   /translation="MHHHSELIEVLRPHLKWHRARLDFLSAFVLALIRVRSVNLAQIAL
FT                   ALNPWVHIASNYRRCQRFLAEFRLQQEVIGRLILKLLPQDPAHKLVLSLDRTEWTLGQA
FT                   SINLLFIGVAHQGVAYPLVWCFLGKAGSSNLQERLGLLRRLLTFLPKERIQSLCADREF
FT                   ACTGFLRYLRWQQLPYTLRIKAGNRVTYKGRSRPVQQLFRHLDYGAWEALPKPVKLWGQ
FT                   PTYLMGSRLRKGEYLLLITEAEPERAPARYARRWEIETLFKACKSQGFDFESTHLTRAE
FT                   RIESLVALMSIALVWAHRVGEWRLQTQPIPIKNHARKLYSTFRYGLDYLRQLLFAPEAR
FT                   KAELYACVRLLSCT"
     atgcatcatc atagcgaact catcgaagtt ctacgacccc atctgaagtg gcatcgcgcc        60
     agactggatt ttctgtcggc ctttgtgctg gctttgatcc gagtccggag tgtcaacctg       120
     gcccagatcg ccctggcctt gaacccctgg gtgcacatag cctccaacta ccgtcgctgt       180
     caaaggttcc tggccgagtt caggttgcag caggaagtca tcggacggct gatcttgaag       240
     ctcttgccac aagacccggc gcacaagctg gttttgagcc tggatcgtac cgagtggacc       300
     ttgggtcagg ccagcatcaa cctgctgttc attggagtgg cccatcaggg ggtagcctac       360
     cccctggtgt ggtgcttcct gggtaaggcc ggtagcagta atctgcagga gcgactgggc       420
     ttgcttcgac ggctgctcac gttcttaccc aaagagcgca tccagtccct gtgtgcggat       480
     cgggagtttg cctgtaccgg ttttctgcgc tacctgcgct ggcagcaact gccctacacc       540
     ctgcgcatca aagcggggaa ccgggtaacc tacaagggcc gcagccgacc cgtccagcag       600
     ttgttccgac atctggacta cggggcgtgg gaagccttac ctaaaccggt caaactgtgg       660
     gggcaaccca cctacctgat gggcagtcgt ttgcgaaagg gggagtacct gctgctgatt       720
     actgaggcgg agccggagcg ggcccctgcc cgctatgccc ggcggtggga gatcgagacc       780
     ctcttcaagg cttgcaaatc gcagggcttc gacttcgaat ccacccacct gactcgggct       840
     gaacggattg agtcgctggt tgcattgatg agcatcgctc tagtctgggc gcatagggtt       900
     ggtgaatggc gtctacaaac ccagcccatc cccatcaaaa accatgcgcg caagctctac       960
     tccaccttcc gctatgggct tgactatcta cgtcaacttc tctttgcccc agaagctagg      1020
     aaagcagaac tgtacgcttg tgtgaggctt ttgtcgtgta cctag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page