(data stored in ACNUC7421 zone)

EMBL: CP001743.PE445

CP001743.PE445       Location/Qualifiers
FT   CDS_pept        436662..438038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0450"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; InterPro IPR001463:IPR001734;
FT                   KEGG: cps:CPS_3842 amino acid/cation symporter; COGs:
FT                   COG1115 Na+/alanine symporter; SPTR: A3JAY1 Putative
FT                   sodium/alanine symporter; PFAM: Sodium:alanine symporter
FT                   family; TIGRFAM: amino acid carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27227"
FT                   /protein_id="ADD27227.1"
FT                   /translation="MDILTLNDYVNRAVYGEWMMLVFILVGLYLSLRTGFPQLLRLGVA
FT                   LRETLGAIRERFLSFGGQITPFQAAMVAMSATIGTGHIIGMVGAVVLGGPGAVLWMWVA
FT                   YLVGMATKFSEAVLAVHFRRQYTDGSVLGGPMVYIRYGLGRRMAWLAALFALFTAIAAF
FT                   GIGNLSQSGAVGAALAQEFNVPPAVTGLLVALLVGILLAGGIRSVARFAQMIVPLKLVL
FT                   FLLAILPLIVIHLESLPAALALVFSSALSFQAAAGGAAGAAVSLGLAEILKAGVGRGIF
FT                   ANEAGLGSAAIAHAQAQVDHPVRQGFWGLTEMLLSLTVTTLMALTFIASGLWQRFLGGD
FT                   RVEAARALFAEHPLGVAMLGLMLAVFALGTMVSWGFYGEEGAAYLFGEGIRWPYRLTFV
FT                   TFAFVGPMGGLAALTSVADTLNGLMAIPNLVALLALGGLVGRLVREFFSGMPWQPPEED
FT                   "
     atggatatac tcacgcttaa cgactacgtc aatcgagcgg tctacggcga atggatgatg        60
     ctggtgttca tcctggtggg gctatacctc tccttgcgca ccggctttcc gcagttgctg       120
     cggctggggg tggcgctccg tgaaacgctg ggggctattc gagagcgctt cctgagcttt       180
     ggaggccaga tcacgccctt ccaggctgcg atggtggcta tgtcggccac catcggaacc       240
     gggcacatca tcggcatggt gggtgcagtg gtgctggggg gccccggtgc ggtgctgtgg       300
     atgtgggtgg cctacctggt gggcatggcc accaagtttt ccgaggcggt tctggcggtg       360
     cactttcgac gccagtacac cgatggctcg gtgttgggtg gccctatggt gtatatccgc       420
     tatggcctgg gccgacggat ggcctggctg gcggctttgt ttgccctctt taccgctatt       480
     gctgcctttg gaatcggcaa cctttcccag tctggggcgg tgggggcggc cctggcgcag       540
     gaattcaacg tgccgccagc ggttaccggc ctgctggttg cgctgctggt gggaattttg       600
     ctggccggcg gcatccgttc ggtggcgcgc ttcgcccaga tgatcgtgcc cctcaagctg       660
     gtgttgtttt tgctggcgat tctgcccctt attgtcatcc acctcgagag cctgcccgcg       720
     gccctggcgc tggtgttttc ctcggcctta agctttcaag cggccgccgg gggggctgcg       780
     ggggcggcgg tctcgctggg cctggccgag attctaaaag caggggtggg gcggggcatc       840
     tttgccaatg aagccggcct gggctcggct gccattgccc atgcacaggc ccaggtcgat       900
     cacccggtgc ggcagggttt ctggggcctt acggagatgc tcttaagcct aaccgtgacc       960
     accctgatgg ccctgacctt tatcgccagc gggctctggc aacgcttttt gggcggcgac      1020
     cgggtggaag cggcccgtgc tttgttcgcc gagcacccgc tgggggtggc catgctgggc      1080
     ctgatgctgg cggtttttgc cctgggaacc atggtttcct gggggtttta cggtgaagaa      1140
     ggcgcggcct atctgtttgg cgagggcatc cgctggcctt accgcctaac ctttgtgacg      1200
     tttgcatttg tggggccgat ggggggtctg gcggccctga ccagcgtggc cgataccctc      1260
     aacggtttga tggccatccc caacctggtg gccctgctgg ccctgggggg gctggtgggc      1320
     cggctggtgc gggagttctt cagcggaatg ccctggcagc cgccggagga agactag         1377
//

If you have problems or comments...

PBIL Back to PBIL home page