(data stored in ACNUC7421 zone)

EMBL: CP001743.PE447

CP001743.PE447       Location/Qualifiers
FT   CDS_pept        complement(438717..439493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0452"
FT                   /product="undecaprenol kinase"
FT                   /EC_number="3.6.1.27"
FT                   /note="TIGRFAM: undecaprenol kinase; PRIAM:
FT                   Undecaprenyl-diphosphatase; PFAM: Bacitracin resistance
FT                   protein BacA; InterPro IPR003824; KEGG: wsu:WS1290 putative
FT                   undecaprenol kinase bacitracin resistance protein; COGs:
FT                   COG1968 Uncharacterized bacitracin resistance protein;
FT                   SPTR: O67939 Undecaprenyl-diphosphatase; PFAM: Bacitracin
FT                   resistance protein BacA; TIGRFAM:
FT                   undecaprenyl-diphosphatase UppP"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27229"
FT                   /protein_id="ADD27229.1"
FT                   /translation="MTIFEALILGILEGLTEFLPISSTGHLTLAAHLLQLDIENDPFIK
FT                   SFIVVIQLGAILAVLALYFQRFLRDIEVWKRIIVAFIPTGILGFLLADVIENVFLGNDL
FT                   IVVINLVGVGILLLFVDRWLQHHKRYDDVNQMPVPHAVLIGLSQALAMMPGVSRSGATI
FT                   VGGMALGLSRRAAAEFSFILAVPTMLSATGFSLVRHMDQFRADSWGLLVVGFLAAFISA
FT                   LLTVRWLLDFVSRNSFVPFAIYRILIGVVYGVFFLR"
     gtgaccattt ttgaagcgct catcctgggc attctggagg gtttaaccga gttcctgccc        60
     atctcctcca ccggccacct taccctagcc gctcacctgc tccagctcga tatcgaaaac       120
     gatcctttta tcaaaagctt catcgtggtt atccagctag gagccattct ggctgtttta       180
     gccctgtact ttcagcgttt tctgcgggat atagaggttt ggaagcgcat tattgtggcc       240
     tttattccca ctggcattct gggtttttta ctggccgatg tgattgagaa cgtgttcctg       300
     ggtaacgacc taattgtggt gattaatctg gttggcgtgg gcattctttt gctgttcgtg       360
     gatcgctggc tgcaacacca taagcgctac gacgatgtca atcaaatgcc tgtgccgcac       420
     gccgttttga tcggtctgtc gcaagccctc gccatgatgc caggggtctc gcgcagcggg       480
     gctaccatcg tggggggtat ggccctgggg ctatcccgtc gggccgccgc cgagttctcc       540
     ttcatcctgg ccgtgcccac catgctctcg gccaccgggt tctccctggt gcgccacatg       600
     gatcagttcc gcgccgatag ctggggtctg ctggtcgtgg gttttctggc cgctttcata       660
     tcggctttgc ttacggtgcg ctggctcctg gacttcgtaa gccgcaacag ctttgtaccc       720
     ttcgccatct accgcattct gatcggggtg gtgtacgggg tgtttttcct gcgctag          777
//

If you have problems or comments...

PBIL Back to PBIL home page