(data stored in ACNUC7421 zone)

EMBL: CP001743.PE448

CP001743.PE448       Location/Qualifiers
FT   CDS_pept        439569..440201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0453"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="InterPro IPR001228; TIGRFAM: 2-C-methyl-D-erythritol
FT                   4-phosphate cytidylyltransferase; COGs: COG1211
FT                   4-diphosphocytidyl-2-methyl-D-erithritol synthase; SPTR:
FT                   Q5SLX2 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; KEGG: bha:BH0107
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   PFAM: Uncharacterized protein family UPF0007; TIGRFAM:
FT                   2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27230"
FT                   /protein_id="ADD27230.1"
FT                   /translation="MKVSVLLPAAGSGERIGRGPKAFLRVGGKTLLEWALEGFAWADEV
FT                   VVALPPGFRMDGLKTVPGGQTRQQSVFNLVQAATGEVVLVHDVARPFVVRSAVERLLEA
FT                   VRATGAASLVVSVPDTLVREEAGRYGEVIAREHHRLVQTPQGFRRELLWQAHQQARAAG
FT                   IEFTDDAQLVRWLGHPVVLVEGDRRMFKVTYPEDLILAEGLAQVWNC"
     atgaaggttt cggtgctgtt gccggcggcc ggttcgggcg aacgaatcgg gcgggggccc        60
     aaggcttttt tgcgggtggg tgggaaaacc ctgctggaat gggccctcga gggttttgcc       120
     tgggccgatg aggtggtggt ggccctcccc ccgggttttc ggatggatgg cctgaaaacc       180
     gttccaggcg gacaaacccg ccaacagagc gtgtttaatc tggtgcaggc agccaccggc       240
     gaggtggtct tggtgcacga tgtggcccgg cccttcgtgg tacggtcggc ggtggagcgg       300
     ctgctggagg ccgtccgggc tacaggcgca gccagcctgg tggtgtcggt gcccgacacc       360
     ctggtgcggg aagaggccgg gcgctacgga gaggtgatcg ctcgcgagca ccaccggctg       420
     gtgcagaccc cccagggctt ccgccgcgag ctgctatggc aggcccacca gcaggcccgg       480
     gcggccggga tcgaatttac cgatgatgcg cagttggttc gctggttggg tcatccggtg       540
     gtgctggtgg agggcgaccg tcggatgttc aaggtgacct atcccgaaga cctgattctg       600
     gcagaagggt tggcgcaggt atggaactgc tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page