(data stored in ACNUC7421 zone)

EMBL: CP001743.PE449

CP001743.PE449       Location/Qualifiers
FT   CDS_pept        440189..441016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0454"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritolkinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PRIAM: 4-(cytidine
FT                   5'-diphospho)-2-C-methyl-D-erythritol kinase; PFAM: GHMP
FT                   kinase; GHMP kinase domain protein; InterPro
FT                   IPR013750:IPR006204:IPR004424; KEGG: glo:Glov_2596
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; COGs:
FT                   COG1947 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   2-phosphate synthase; SPTR: P83700
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinases N terminal domain; GHMP kinases C terminal;
FT                   TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27231"
FT                   /protein_id="ADD27231.1"
FT                   /translation="MELLAPAKVNLGLSVLGRRPDGYHELHTLFAALRVGDRLWVEAIP
FT                   EGIELEVWGRGLPADTNNLVYKAAQAYLTAAGWPGGVRVVLEKNLPLAAGLGGGSSDAA
FT                   AVLRALSQLYPSALELPGLALGLGADVPFFLGPGLAEGRGVGERLTPLPPIRAALVLVN
FT                   PGIAVSAAEAYKGLTPEMWQPELDVAGVVEAIQVGEEPPYWNTLERSVFRLHPYLEALK
FT                   QELYRLGLRGVLMSGSGSTLFGLARDGAEAGYLAGVLRDKHPGFWVVATETVS"
     atggaactgc tagccccggc caaggtgaac ctgggtcttt cggtgctggg ccgccgcccc        60
     gacggctacc acgaattgca caccctgttt gcagccctgc gggtgggcga ccgcctctgg       120
     gtggaggcca ttcccgaggg aattgagctg gaggtgtggg gcaggggcct gcccgctgat       180
     accaacaacc tggtatacaa ggcggcgcag gcttacctga cggctgctgg ctggcccggt       240
     ggggtgcggg tggtactgga aaagaacctg cccctggccg cggggctggg tgggggttcc       300
     tccgatgcgg cggcggtgct gcgggcttta tcccagctct atccatccgc cctcgagctg       360
     ccggggctgg cccttgggct gggggccgac gtgccctttt tcctggggcc gggcctggcc       420
     gaagggcggg gggtgggtga acgactgacc cccctgccgc ccatccgggc tgcgctggtg       480
     ctggtgaacc cgggcattgc ggtttcggcg gctgaggcct acaagggcct tacacccgag       540
     atgtggcagc ccgaactgga tgtggcgggg gtggtggaag ccatacaggt gggggaggag       600
     cccccttact ggaatacgct cgagcgctcc gtatttcgcc tgcaccccta cctcgaggcc       660
     ctcaaacaag agctgtaccg cctggggctc aggggcgtgc tgatgtcggg ctcgggttct       720
     accctgtttg ggctggcccg tgatggggcc gaggccgggt atctggctgg ggtgctgcgg       780
     gataagcacc ctgggttctg ggtggtcgct accgagaccg taagctaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page