(data stored in ACNUC7421 zone)

EMBL: CP001743.PE45

CP001743.PE45        Location/Qualifiers
FT   CDS_pept        complement(39626..40051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0046"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; SPTR:
FT                   A7JPS5 Possible ATPase; InterPro IPR003442; COGs: COG0802
FT                   ATPase or kinase; KEGG: eba:ebA4453 hypothetical protein;
FT                   PFAM: Uncharacterised P-loop hydrolase UPF0079; TIGRFAM:
FT                   conserved hypothetical nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26827"
FT                   /protein_id="ADD26827.1"
FT                   /translation="MLLKHLEDTRSVAHRLAHSLPEGALVLLTGPMGAGKTTLVQFIAQ
FT                   ALGFRGEVTSPTYTLIHEYPSPQGLIVHIDAYRMADQEELFNLGLEDYLPEARLVLIEW
FT                   GKPEVFPDSLEIRLTPTEHGRRLELIPHGRASLPKLA"
     gtgctgctga agcatctgga agacacccgt tcggttgccc accggctcgc acacagcctg        60
     cccgaagggg cgctggtgct gcttacgggg cctatgggcg cgggcaaaac caccctggtg       120
     cagttcatcg cccaggccct ggggtttcgg ggcgaggtga ccagccccac ctacaccctg       180
     attcacgaat accccagccc gcagggcctg atcgtgcaca ttgatgccta ccgcatggcc       240
     gaccaggagg agctttttaa tctgggcctc gaggactacc tgcccgaggc ccgcctggtg       300
     ttgatcgagt gggggaagcc cgaggtgttt ccggacagcc tggagatccg cctgacccct       360
     accgagcacg ggcggaggct cgagctcatc ccccacggcc gcgcatcact tccgaagctg       420
     gcctga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page