(data stored in ACNUC7421 zone)

EMBL: CP001743.PE450

CP001743.PE450       Location/Qualifiers
FT   CDS_pept        441173..442255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0455"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   thiB subfamily"
FT                   /note="TIGRFAM: ABC transporter, periplasmic binding
FT                   protein, thiB subfamily; PFAM: extracellular solute-binding
FT                   protein family 1; InterPro IPR006059:IPR005948; KEGG:
FT                   nmn:NMCC_0042 thiamin-binding periplasmic protein; COGs:
FT                   COG4143 ABC-type thiamine transport system periplasmic
FT                   component; SPTR: A6ZIJ2 ABC transporter; PFAM: Bacterial
FT                   extracellular solute-binding protein; TIGRFAM: ABC
FT                   transporter periplasmic binding protein, thiB subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27232"
FT                   /protein_id="ADD27232.1"
FT                   /translation="MYRTPKAGWLVGLGALLLLTFGLWPARAQQTTLTVLTHDSWSLDK
FT                   NLVARFERESGIRVRFLKGGDAGEMLNKAILSKGAPIADVIYGFDNTMLSRALEADILQ
FT                   PYRSPELANLRPELRIDQTFRATPVDFGYVALNYDRDFFKDKPLPQRFADLALPEFAGL
FT                   LVVQNPATSSPGLAFLLATVAAFGEDGYLDFWENLRKNGVRVVSGWSEAYYTHFTRAGG
FT                   DRPLVVSYSTSPAAELYYSEAQPKPTEPPTANLFLPRSSFFQVEYVGILKGTRNLRAAQ
FT                   RFVDWLVSKPVQENIPTQMWVYPARQDARLPEVFRFAQVPPEPARLTPQQIANNRERWI
FT                   REWTQVVVQGQTAQAVKARR"
     atgtacagaa ccccaaaagc tggatggttg gttgggttag gtgcgctgct actgctgacg        60
     tttgggctat ggcccgcacg ggcgcaacaa accaccctga ccgtcctgac ccacgatagc       120
     tggagcctcg acaagaacct ggttgcccgc ttcgagcggg agagcggtat tcgggttcgc       180
     tttctgaagg gcggcgatgc cggcgagatg ctcaacaaag ccattctgag caaaggcgcc       240
     cccattgctg atgtgatcta cggcttcgat aacaccatgc tctcgcgcgc cctcgaggct       300
     gatatcctcc agccgtaccg ctcgccggag ctggccaacc tgcgccctga actccggatt       360
     gaccagacct tccgggccac gccggtggac tttggctatg tggcccttaa ctacgaccgg       420
     gatttcttca aggacaagcc cctgccccag cgcttcgccg acctggcatt gccggaattt       480
     gccgggctgt tggtggtgca gaacccggct accagctcgc cggggctggc tttcctgctg       540
     gccaccgtgg cggcttttgg ggaggatggt tacctggact tctgggaaaa cctgcgcaag       600
     aacggggtgc gggtggtgag cggctggagc gaggcctatt acacccactt cacccgggcc       660
     ggcggcgacc gcccgctggt ggtctcgtac agcaccagcc cggccgccga actgtactac       720
     agcgaggccc agcccaagcc caccgaaccc cccacggcca acctcttctt gccccgtagc       780
     tcgtttttcc aggtggagta tgtgggcatt ttgaagggta cgcgcaatct gcgggcggcc       840
     cagcgctttg tggactggct ggtttctaag cccgtacaag agaacatccc cacccagatg       900
     tgggtctatc cggcccggca ggatgccagg ctgccggagg tcttccgctt tgcccaggtg       960
     ccccctgagc cagcccgcct gacgcctcag cagatcgcaa acaaccgcga gcgctggatt      1020
     cgtgagtgga cgcaggtggt ggtgcaaggg cagacggcac aggcggtaaa ggcgcggcgt      1080
     tag                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page