(data stored in ACNUC7421 zone)

EMBL: CP001743.PE452

CP001743.PE452       Location/Qualifiers
FT   CDS_pept        complement(443834..444808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0457"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; SPTR: A7LSG1 Putative
FT                   uncharacterized protein; InterPro IPR013525; COGs: COG1277
FT                   ABC-type transport system involved in multi-copper enzyme
FT                   maturation permease component; KEGG: bpt:Bpet0290 putative
FT                   ABC-2 type transport system permease protein; PFAM: ABC-2
FT                   type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27234"
FT                   /protein_id="ADD27234.1"
FT                   /translation="MQHSSTSRRREGSPWTGLWAVFFKEMADHLSSTRMRILEVLILLS
FT                   AVGAVYAGAQTLRQTISEDPFLLLRVFTAAQDPLPSFVAFLSFFLPLAAIALGFDAING
FT                   EYSRNTLSRILAQPIYRDALLWGKFLAGLATIALILLALFLLVVGLSLIFLGVPPSSEE
FT                   VARALLFLLATLAYTGVWLGIALVTSVLFRSAATSALAAIAVWLFFALFWGIIAQLLAQ
FT                   AVAPFDPFNPESELRQTEALLAFSRLSPNTLYAEAIQALLNPGVRSLGPVLISQLEGAL
FT                   LGSPLPLGQSFLLAWPQLTGLIALTIGLFAVAYVLFQRREVRA"
     atgcagcata gctctacctc gcgtcgccgt gaaggctcgc cctggacggg gctgtgggca        60
     gttttcttca aggagatggc cgaccacctg agcagcaccc ggatgcgcat cctggaggtg       120
     ctcatcctgc tctcggcggt gggggcggtc tatgccgggg cccagaccct gcgccagacc       180
     atcagcgaag accccttcct cctgctgcgg gtttttactg cggcccagga tccgctgccc       240
     tcgtttgtgg ccttcctgag cttttttttg cccctggccg ccattgccct gggttttgat       300
     gccatcaacg gtgagtacag ccgcaacacc ctttcgcgca tcctggccca gcccatctac       360
     cgcgatgccc tgctgtgggg caagttttta gccgggctgg ctactatagc cctgatcctg       420
     ctggccctgt ttttgctggt ggtggggctg agcctgatct tcctgggcgt accccccagc       480
     agcgaggagg tcgcgcgggc gttgctcttc ttgctggcca ccctggccta taccggggtc       540
     tggctgggga ttgccctggt cacctcggtg ctcttccgca gcgccgccac ctcggcgctg       600
     gcggccattg cggtctggct cttcttcgcg ctgttctggg gcatcattgc ccagttgctg       660
     gcccaggctg tggccccttt cgaccccttc aaccccgaga gcgagctgcg ccagaccgag       720
     gccctgctgg ctttctcacg cctttcgccc aacaccctgt acgccgaggc cattcaggcc       780
     ctgctcaacc ctggggtgcg cagcctgggg ccggtgctca tcagccagct cgagggggcc       840
     ttgctgggct caccccttcc cctggggcag agcttcctcc tggcctggcc gcagcttacg       900
     ggcctgatcg ccctcaccat agggctcttc gccgtggcct acgtgctctt ccagcggcgg       960
     gaggtgcggg cttag                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page