(data stored in ACNUC7421 zone)

EMBL: CP001743.PE455

CP001743.PE455       Location/Qualifiers
FT   CDS_pept        447034..447501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0460"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; CS; SPTR: P46729 18
FT                   kDa antigen 1; InterPro IPR017447:IPR002068; COGs: COG0071
FT                   Molecular chaperone (small heat shock protein); KEGG:
FT                   wpi:WPa_0614 heat shock protein, HSP20 family; PFAM: CS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27237"
FT                   /protein_id="ADD27237.1"
FT                   /translation="MLDIVRNVPVQTMPLRSWNLSSVNDFFHEFDRLWNEVTTSLGSAW
FT                   PAGVYPYDLYETGDSLVLEMAVPGLRKDDLEVRLEGNRLTIRGTYPEAQGSDERRYWSR
FT                   GLPRGSFVQSLTLPASVEVDKIQATITDGLLRLTLPKVEQARVRKIAISAA"
     atgctggaca ttgttcggaa cgtacctgtt cagacgatgc ctctgcggag ctggaatctc        60
     tcgagcgtaa acgacttctt ccatgagttc gaccggctct ggaacgaggt gacgacatcc       120
     ctgggcagcg catggcccgc tggtgtctac ccctacgatc tttacgagac tggggacagc       180
     ctggtgctgg agatggcggt gccgggcctg cgcaaagacg acctcgaggt acgcctggaa       240
     ggcaaccggc tgaccatccg gggtacttac ccagaggccc agggcagcga tgagcgccgc       300
     tactggtcgc ggggtctgcc gcgcggcagc ttcgtgcaga gcctgaccct acccgcctcg       360
     gtggaggtgg acaagattca ggccaccatc accgatggcc tcctgcgcct gaccctgccc       420
     aaggtggagc aggcccgcgt gcgcaagatc gccatcagcg cggcctaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page