(data stored in ACNUC7421 zone)

EMBL: CP001743.PE46

CP001743.PE46        Location/Qualifiers
FT   CDS_pept        40126..41331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0047"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; SPTR:
FT                   A6E7B4 Tetracycline resistance protein; InterPro
FT                   IPR001958:IPR011701:IPR007114:IPR005829; COGs: COG2814
FT                   Arabinose efflux permease; KEGG: rce:RC1_1688 tetracycline
FT                   resistance protein, class C; PFAM: Major Facilitator
FT                   Superfamily; TIGRFAM: Multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26828"
FT                   /protein_id="ADD26828.1"
FT                   /translation="MSKSASIPFILISVLINVMGLGLVIPVLPKLIETLAGGVEAGARL
FT                   NGLFFAVYAVMQFAFGPILGMLSDRYGRRPVLLASLVGTAVDYLIAALTQSIWVLFAAR
FT                   VIAGALGASLSTANAYIADISKPEERARNFGLIGATFGMGFVLGPVLGGLLGNIDLRLP
FT                   FYFAAGLAFLNFLYGYFVLPESLKPENRNTQARSLNPFVALGILRKTPILRGLSLSLAL
FT                   IFLAFGSLQSVWVLYTAYKFGWEPLEVGFSLFLVGLGGVIVQAGLVRPVVAHLGERRAL
FT                   TLAQSMGLFSFTLYGLATQGWMMYAIIALAALSNLGQPLIQSFLTREVSPQEQGTLQGA
FT                   LAGLQSLTVAVGGLLGGFLFSVVARPEVAPWLVGLPFFVGALLYATAAANTARLFRGLR
FT                   GS"
     atgtcgaaga gcgcctctat tcccttcatc ctgatttcgg tacttatcaa cgtgatgggc        60
     ctgggtctgg tcattccggt cttgcccaag ctcatcgaga ccctggccgg cggcgtggag       120
     gccggggccc ggctcaatgg cctgtttttt gcggtgtacg ccgtaatgca attcgccttt       180
     ggccccatcc tgggcatgct ctccgaccgc tacgggcgcc gcccggtgct gctggcctcg       240
     ctggtgggca ccgccgtgga ttacttgatt gccgccctca cccagtccat ctgggtgctg       300
     tttgcggcgc gggtgattgc cggggcattg ggggccagcc tctcgaccgc caacgcctac       360
     attgccgata tttccaaacc cgaagagcgg gcccgcaact ttggcctgat tggggctacc       420
     tttgggatgg gtttcgtgct ggggccggtg ctgggcgggc tactgggcaa cattgacctg       480
     cgcctgcctt tctactttgc ggcgggactg gccttcctca actttttgta tggctacttt       540
     gtgctgcccg agtcgctcaa gccggaaaac cgcaacaccc aggcccgctc gctcaacccg       600
     tttgtggccc tggggatctt gcgcaagacc cccatcctgc gggggttatc cctgagcctc       660
     gcgctcatct ttctggcctt cgggtctttg cagagtgtgt gggtgctgta caccgcctac       720
     aagtttggct gggagccgct cgaggtgggc ttctcgctgt ttctggtggg cttgggcggg       780
     gtgattgtcc aggccgggct ggttcggccc gtggtggccc acctggggga gcgccgggcc       840
     ctgaccctgg cccagagcat ggggctgttc tccttcacct tgtacggcct ggccacccag       900
     ggctggatga tgtacgccat catcgccctg gccgccctga gcaacctggg ccagcccctc       960
     attcagtcct tcctgacccg cgaggtctcg ccgcaggagc agggcaccct gcaaggggcg      1020
     ctggccgggc tgcaaagcct gacggtggcg gtgggcggtc ttttgggtgg gttcctcttt      1080
     tcggtggtgg cgaggcccga ggtggccccc tggctggtgg ggctgccttt ttttgtgggg      1140
     gccctgctct acgccacggc ggcggccaac accgcccggc tgtttcgcgg cctgcgaggc      1200
     agttag                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page