(data stored in ACNUC7421 zone)

EMBL: CP001743.PE460

CP001743.PE460       Location/Qualifiers
FT   CDS_pept        450565..451059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0465"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; SPTR: A6NUQ9
FT                   Putative uncharacterized protein; InterPro IPR003711; COGs:
FT                   COG1329 Transcriptional regulators similar to M. xanthus
FT                   CarD; KEGG: dps:DP2731 transcription factor; PFAM:
FT                   CarD-like/TRCF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27242"
FT                   /protein_id="ADD27242.1"
FT                   /translation="MSEYRPGDKVVLPPYGVGVVAGIAQRSVAGSDRAYYQVDFPGTRS
FT                   KAYVPVEAPQTTRLRRALSPDQVNEILALLQEGRLPLPRQWAARHRKTTEILADGDPFR
FT                   IATLAGQLRAWELEKGLPDLDRQALRRAMHLLAEEISQVLEITLDEARKLFEEAVGESL
FT                   N"
     gtgagcgaat accgtccagg agacaaggtt gttttgccgc cgtatggtgt aggagtggtg        60
     gcggggatcg cccagcgttc ggtggctggc tcggacagag cctattatca agttgatttc       120
     cctggaaccc gctcgaaggc ttatgtgccc gtagaagcgc cgcaaaccac ccgtttgcgt       180
     cgggccttgt cgccggatca ggtaaacgag attctagcct tgctacaaga aggccgactg       240
     cccctgcccc gtcagtgggc tgcccgccac cgcaagacca ccgagatcct ggccgatggc       300
     gaccctttcc gcattgccac cctggccggt caactccggg cctgggaact tgaaaagggc       360
     ctgcccgatc tcgaccgtca agcccttcgc cgggccatgc accttctggc agaggaaatt       420
     tcgcaggtgc tcgagatcac cctcgacgaa gcccgcaagc tcttcgaaga agccgtgggc       480
     gagagcctaa actaa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page