(data stored in ACNUC7421 zone)

EMBL: CP001743.PE461

CP001743.PE461       Location/Qualifiers
FT   CDS_pept        complement(451120..452349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0466"
FT                   /product="phosphonopyruvate decarboxylase-related protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: sat:SYN_02641 cofactor-independent
FT                   phosphoglycerate mutase; COGs: COG3635 phosphoglycerate
FT                   mutase AP superfamily; InterPro IPR006124:IPR004456; SPTR:
FT                   Q5SM27 Probable 2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase; PRIAM: Phosphoglycerate mutase;
FT                   PFAM: metalloenzyme domain protein; TIGRFAM:
FT                   phosphonopyruvate decarboxylase-related protein; PFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; Metalloenzyme superfamily; TIGRFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase, archaeal form"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27243"
FT                   /protein_id="ADD27243.1"
FT                   /translation="MDMLPILTELSQKTPTKILLVVLDGVGGLPQTPGGPTELAAAHTP
FT                   NLDALAQKSALGLLTPVYPGLAPGSGPGHLSLFGYDPFKYLVGRGALSAIGIGADFKDG
FT                   DVAVRGNFATLDAAGLVKDRRAGRPSDAENVRVVNRLKTAIREINGVQVTFYTESEHRF
FT                   VVILRGEGLGDKVSDTDPQKTGVAPLQAQALEAGDTASAKTASVLNTLTTRIQEVLRDE
FT                   PQINGALFRGISEKPRFPGMAQVYKLNAACVASYPMYKGVASLVGMEVLPVEGVEDAPE
FT                   GKVKALQENWAKYDFFYLHFKKTDSTGEDGNFEEKVHKVELFDHLLPELLALKPDVLAI
FT                   TGDHSTPSVLKAHSWHPVPLLLYGPYLRNDAAQRFTEDEAARGSLGHLRGVELMPLLLA
FT                   HAGKLQKYGA"
     atggacatgc tccccatcct cacagagcta tcgcaaaaaa cccccaccaa gattctcctg        60
     gttgtgctgg acggcgtagg cggcctgccc cagacccccg gcggccccac cgagctggcc       120
     gcagcgcata cccccaacct ggatgccctg gcacagaaga gcgccctggg gctcctgacc       180
     ccggtctacc ccggtctggc ccccggttcc ggccccggcc acctctcgct ctttggctac       240
     gaccccttca agtacctggt ggggcgcggg gcgctctcgg ccatcgggat tggggccgac       300
     ttcaaagacg gcgacgtggc ggtgcgcggc aactttgcca ccctggatgc cgccgggctg       360
     gtcaaggatc gccgggcagg ccgccccagc gacgcggaga atgtgcgtgt ggtgaacaga       420
     ctgaaaaccg ccatccgcga gattaacggc gtccaggtaa ccttctacac cgagagcgag       480
     catcgctttg tggtgatttt gcgtggggaa gggctgggcg acaaggtaag cgacaccgac       540
     ccccagaaaa ccggtgtggc cccgctgcaa gcccaggccc tcgaggccgg cgacaccgcc       600
     agcgccaaaa ccgccagcgt gctcaacacc cttaccaccc gcatccagga ggtattgcga       660
     gacgagccgc agatcaacgg ggcgctcttc cggggcatct ccgaaaagcc caggttcccc       720
     ggcatggccc aggtttacaa gctaaacgcg gcctgtgtgg ccagctaccc catgtacaaa       780
     ggcgtagcca gcctggtggg catggaggtg ctgccggtgg aaggggtgga agacgctcca       840
     gagggcaagg taaaggccct acaggaaaac tgggccaagt acgatttctt ctatctgcac       900
     ttcaagaaaa ccgacagcac cggcgaggac ggtaattttg aagaaaaagt gcataaggtc       960
     gagctttttg accacctgtt gcccgagctg ctggccctga agcccgatgt gctggccatc      1020
     accggcgacc actccacccc ttcggttttg aaagcccact cctggcaccc ggtgccgctg      1080
     ttgctctatg gcccctacct ccgcaacgac gccgcccagc gcttcaccga ggacgaggcc      1140
     gccagaggca gcctgggcca cctgcgtggg gtggagctga tgcccttgct gctagcccat      1200
     gccggcaagc tgcaaaagta cggcgcctag                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page